SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016324 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016324
Domain Number 1 Region: 23-113
Classification Level Classification E-value
Superfamily Immunoglobulin 1.06e-33
Family V set domains (antibody variable domain-like) 0.0000902
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016324   Gene: ENSMODG00000013046   Transcript: ENSMODT00000016625
Sequence length 115
Comment pep:novel chromosome:BROADO5:1:713208895:713209468:1 gene:ENSMODG00000013046 transcript:ENSMODT00000016625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSPSQFFCLLVLWVQESSTATVMTQTPASLSVTLGETVTISCRASQSISNYLAWYQLSP
GKPPKSLIYAATYLPSGIPARFSGSGYGTDFTLKISPVEAEDVADYYCLQYNQYP
Download sequence
Identical sequences F7G170
ENSMODP00000016324 ENSMODP00000016324 13616.ENSMODP00000016324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]