SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016325 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016325
Domain Number 1 Region: 679-880
Classification Level Classification E-value
Superfamily Fibronectin type III 1.29e-39
Family Fibronectin type III 0.00098
Further Details:      
 
Domain Number 2 Region: 483-674
Classification Level Classification E-value
Superfamily Fibronectin type III 8.69e-31
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 3 Region: 352-453
Classification Level Classification E-value
Superfamily Fibronectin type III 2.64e-26
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 4 Region: 134-229
Classification Level Classification E-value
Superfamily Immunoglobulin 1.82e-22
Family I set domains 0.0075
Further Details:      
 
Domain Number 5 Region: 1330-1417
Classification Level Classification E-value
Superfamily Immunoglobulin 1.82e-19
Family I set domains 0.024
Further Details:      
 
Domain Number 6 Region: 254-348
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000106
Family I set domains 0.037
Further Details:      
 
Domain Number 7 Region: 1098-1188
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000335
Family I set domains 0.04
Further Details:      
 
Domain Number 8 Region: 988-1064
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000569
Family I set domains 0.07
Further Details:      
 
Domain Number 9 Region: 1230-1291
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000872
Family I set domains 0.055
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000016325
Domain Number - Region: 889-969
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000186
Family I set domains 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016325   Gene: ENSMODG00000013043   Transcript: ENSMODT00000016626
Sequence length 1427
Comment pep:novel chromosome:BROADO5:4:360539727:360628747:-1 gene:ENSMODG00000013043 transcript:ENSMODT00000016626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIHRLEHRSQEEQREERQRSLHMSSATKRRTFRTSEEEEQFSSLDYSLAAALALTATET
SWEAKLRSEASALEVEKRGEKRVGFGNDWEKIEIDILNVCHLLRERVDQKALWRRTEEKI
REAKEFRELCSSRGPYFWIPLRSHTVWENESVLLTCTVYASPPPQVTWYKNDMRIDPRLF
PAGKYRMKNQFGLYTLEIRRCTVEDSATYTVMVKNAYGQASSFAKVLVRKYLGKEAGFDS
EIFKRLLLGPDVEFESVLQPVFAREKEPFILACTFKQDVPDGQRSIQWFRDGMLLQESKR
RQLQYLDRQASVKVFCAYKEDEGLYTIQVPSPFGSKEQSAYVFVRDAPAEKAGAPGSPLN
VQCHDVNRDCLILTWAPPSDTRGSPIIGYTIERCQGDSGVWETCHEAPGGTCRCPIRGLV
EGQSYRFRVRAVNRAGTSLPSKATELVTMQDPREAERKTVIPFDLGRNIAVSKADSEDSV
IIPSPPTNVRASETRQAYVLLSWDEPSPRGKEDLTYLLEKSVVGSDAWEAVSSETPVKSP
RFALLDLEKGKAYRFRVRAANQYGLSDPSKPSEPITLGDPPATLPPPGSVLSFRAHKTSV
SLKWTCDGDSELLATIYTLESGTLTQTVNNKPIKINKFAVPGLKTGKEYMFCVRSVSEAG
VGESSAESAPVTVKQAIATPSAPYGFALLACGKNDMVIGWKPPKRRGGGKILGYFLDQHD
ESEPKWQSVNQQPVPTRVYKITDLQEGHFYEFRARAVNWAGVGELSEPSDLFECKEWTMA
QPGPPYDVRASEVRASSLMLYWEAPLYQGAGLITGYRVSVQEEGSETWKPLVSDLVSATH
LRVSDLEPGKCYRFQVQAVNSAGIGQPSLPSDSVLMEDKPDAREIKVGVDEEGSVFMAFE
APEAPDSSEFEWAKDYAGPPDPQRITVKDDVCRSKLILKEPSKEDLGIYSVTVTDADEDI
SASHTLTEEELDKLKKLSHEIKNPVIKLISGWNIDILDHGEVRLWLEVEKLSPAAELHLI
FNDKELISSPTHKINFDREKGLVELIIQNFSDEDMGTYTAQLQDGKAKNQITLALVDDSF
DKLLRASAAKRRDWKRKQGPHFVEPLQWKVTEECEVHLTCKAMGCVTNTKKESRFQWFFQ
KKENPKGQYDAQTGDGLLVISEMSKKDEGTYKAVISDDRGEDDTVLDLTGEAYDAILNEL
CRISALLATPLKIQGTEEGIRIFSKVKFFDVDYMKTSWYHKEKRLESGDRLKSGSTLDEI
WLHILDPKDSDKGKYTLEISTGKDIRKLTADLSGQAFDDALAEHQRLNQEFTVNSICFFP
DRAKVVKGLPDVATIMEDKTLCLTCIISGDPSPEITWLKNDQPVAFHDRYRMEVKGTVVT
ITIERVCSEDSGRYGIFVKNKYGSETGLVTVSVFKHGEEPKELRKHK
Download sequence
Identical sequences F7G168
ENSMODP00000016325 ENSMODP00000016325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]