SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016329 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016329
Domain Number 1 Region: 102-181
Classification Level Classification E-value
Superfamily Fibronectin type III 6.98e-26
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 2 Region: 187-278
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000104
Family Fibronectin type III 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016329   Gene: ENSMODG00000013049   Transcript: ENSMODT00000016630
Sequence length 633
Comment pep:novel chromosome:BROADO5:4:360641183:360668234:-1 gene:ENSMODG00000013049 transcript:ENSMODT00000016630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPSPNGPALLLLPSSSLRPGVEQTAWAPRFPQPPEHTVRVEWRREEEDRREERRLERG
KRSKGRRGEAPLTPLPGDPMKWLLVFLIISIPNVYNAEESPKLLQNLRFHSSNFENILKW
DSIQGSPPDTVYNVQYKRYGDPKWKNKDECQNITETSCNLTYETRDTDEQYFAKVTASSR
GQRNIQEWRQTPRFSACRDTLIKPPLVTCIPNVRSVRLVVHPSPTALWTSDGHSQTLEEI
FPDLFYRLQLHVNHTYQMHLEGKKKEYEFFGLAPDTEYQGVTTISIPTPFKESPPYTCRV
RTLADRTWIYSFSGVSLFTMGFLVAVLCYLSYRYVKKPPKQPNSLDVQRVLTFQPLRFIQ
EHILVPAIDFSSSGGLVPPIQYSQVKVPGPREALGAPLPSGLPEITYLGQSEIPIPILLA
HQALPPPSYAPQTILDVGPPSYAPQVVPETKPPTYAPQTLSDPWPPSYGACMEGSGEEIS
PHQDLNGTKGQPQPNQTRTGPNSQTEELQQNSRREEFFHQPPGLRKEQLPSRVLPLVHPT
GPLESVAPGYLSNQISLLSSVQVEDQPFSLPSTPSLLFQPREEMGEAWSLLDSVVCPKDE
LSPPGPERSCLAQASPEFDRLFRDLDLTVQWEP
Download sequence
Identical sequences F7G154
ENSMODP00000016329 ENSMODP00000016329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]