SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016331 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016331
Domain Number 1 Region: 22-117
Classification Level Classification E-value
Superfamily Immunoglobulin 6.57e-30
Family V set domains (antibody variable domain-like) 0.0000644
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016331   Gene: ENSMODG00000013051   Transcript: ENSMODT00000016632
Sequence length 120
Comment pep:known chromosome:BROADO5:1:713181425:713182033:1 gene:ENSMODG00000013051 transcript:ENSMODT00000016632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLTQVFCLLLFWLAGSQGEVVLTQSPASVSVSLGDRVTIKCKASQSLLYSDGKTYLNW
FQQKLGKSIKRTIYQVSNLDSGVPPRFSGSGSGTDFTLTISSEPEDAAMYYCGQSTHFPP
Download sequence
Identical sequences F7G0W0
ENSMODP00000016331 13616.ENSMODP00000016331 ENSMODP00000016331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]