SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016348 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016348
Domain Number 1 Region: 17-112
Classification Level Classification E-value
Superfamily Immunoglobulin 4.64e-31
Family V set domains (antibody variable domain-like) 0.0000915
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016348   Gene: ENSMODG00000013061   Transcript: ENSMODT00000016649
Sequence length 115
Comment pep:known chromosome:BROADO5:1:712971652:712972225:1 gene:ENSMODG00000013061 transcript:ENSMODT00000016649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLLCLLLFLLPGSQGGIVLTQSPASVSVSLGERVTIKCKASQSLLHSDGKTYLHWYQHKQ
GELIKALIYRVSNLHSGVPSRFSGSGSGTDFTLTISSLEPEDVAEYVCGCWPLHS
Download sequence
Identical sequences F7FQE6
ENSMODP00000016348 13616.ENSMODP00000016348 ENSMODP00000016348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]