SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016349 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016349
Domain Number 1 Region: 745-919
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.18e-39
Family MAM domain 0.00051
Further Details:      
 
Domain Number 2 Region: 441-541
Classification Level Classification E-value
Superfamily Immunoglobulin 2.44e-17
Family I set domains 0.038
Further Details:      
 
Domain Number 3 Region: 241-327
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000167
Family I set domains 0.014
Further Details:      
 
Domain Number 4 Region: 48-130
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000168
Family I set domains 0.04
Further Details:      
 
Domain Number 5 Region: 345-427
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000376
Family I set domains 0.022
Further Details:      
 
Domain Number 6 Region: 152-219
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000883
Family I set domains 0.035
Further Details:      
 
Domain Number 7 Region: 536-627
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000981
Family I set domains 0.032
Further Details:      
 
Domain Number 8 Region: 652-728
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000667
Family Fibronectin type III 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016349   Gene: ENSMODG00000013060   Transcript: ENSMODT00000016650
Sequence length 956
Comment pep:novel chromosome:BROADO5:1:282623234:283423014:1 gene:ENSMODG00000013060 transcript:ENSMODT00000016650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLVYSLLWMLIVLLEGISGQGVYASPTVRIVHSGLACNIEEERYSERVYTIREGETLEL
TCLVTGHPRPQIRWTKTAGSASDRFQDSSVFNETLRITNIQRHQGGRYYCKAENGLGSPA
IKSIRVDVYYLDDPVVTVHQSIGEAKEQFYYERTVFLRCVANSNPPVRYSWRRGQEVLLQ
GSDKGVEIYEPFFTQGETKILKLKNLRPQDYANYSCIASVRSVCNIPDKMVSFKLSNKTA
SPSIKLLVDDPIVVNPGEAITLVCVTTGGEPTPTLTWVKSIGNLPEKTVLNGGTLTIPAI
SSDDAGTYSCIANNNVGNPAKKSTSIIVRALKKGRFWITPDPYHKDDTIQIGREVKISCQ
VEAIPSEELIFSWFKNGRPLRSSERMVITQTDPDVSPGTTNLDIIDLKFTDFGTYTCVAS
LKGGGISDISIDVNISSSTVPPNLTVPQEKSPLVTREGDTIELQCQVTGKPKPIILWTRA
DKEVAMPDGSMQMESYDGTLRIVNVSREMSGMYRCQTSQYNGFNVTPREALVQLIVQYPP
AVEPAFLEIRQGQDRSVTMSCRVLRAYPIRVLTYEWRLGNKLLRMGQFDSQEYTEYTLKD
LSNENYGIYNCNIINEAGAGRCTYLVTGKAYAPEFYYDTYNPVWQNRHRVYSYSLQWTQM
NPNAVDRIVAYRLGIRQAGQQRWWEQEIKISGNIQKGELITYNLTELIKPEAYEVRLTPL
TKFGEGDSTIRIIKYSAPVNPHLREFHCGFEDGNICLFTQDDTDNFDWTKQSTATRNTKY
TPNTGPNADRTGSKEGYYMYIETSRPRLEGEKARLLSPVFSIAPKNPYGATNTAYCFSFF
YHMYGQHIGKINLFGADFRQTTIENPLWSSSGNKGQHWNEAHVNIYPITSFQLIFEGIRG
PGIEGDIAIDDVSIAEGECAKQDLATKNSVDGAVGILVHIWLFPAVVLISILNPRR
Download sequence
Identical sequences F7FQE2
ENSMODP00000016349 ENSMODP00000016349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]