SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016350 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016350
Domain Number 1 Region: 24-119
Classification Level Classification E-value
Superfamily Immunoglobulin 1.35e-32
Family V set domains (antibody variable domain-like) 0.0000517
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016350   Gene: ENSMODG00000013062   Transcript: ENSMODT00000016651
Sequence length 122
Comment pep:known chromosome:BROADO5:1:712900821:712901435:1 gene:ENSMODG00000013062 transcript:ENSMODT00000016651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKMAFLTQVLCLLLFWLSGSQGEVVLTQSPASVSVSLGERVTIKCKASQSLLHSNGNTYL
QWFQQKVGKPINALIYGVSNLYSGIPPRFSGSGSGTDFTLTISSLEPEDAAIYYCFQHTH
LP
Download sequence
Identical sequences F7FQ25
13616.ENSMODP00000016350 ENSMODP00000016350 ENSMODP00000016350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]