SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016358 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016358
Domain Number 1 Region: 22-119
Classification Level Classification E-value
Superfamily Immunoglobulin 5.6e-34
Family V set domains (antibody variable domain-like) 0.0000719
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016358   Gene: ENSMODG00000013070   Transcript: ENSMODT00000016660
Sequence length 121
Comment pep:known chromosome:BROADO5:1:712831781:712832388:1 gene:ENSMODG00000013070 transcript:ENSMODT00000016660 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLTQVLCLLLFWLAGSQGEVVLTQSPASVSVSLGERVTIKCKASQSLLHSDGKTYLHW
FQQKLGKSIKRTIYQVSNLDSGVPPRFSGSGSGTDFTLTISSLEPEDAAMYYCGQHTHWP
P
Download sequence
Identical sequences F7FPZ1
ENSMODP00000016358 ENSMODP00000016358 13616.ENSMODP00000016358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]