SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016361 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016361
Domain Number 1 Region: 24-126
Classification Level Classification E-value
Superfamily Immunoglobulin 3.6e-34
Family V set domains (antibody variable domain-like) 0.0000691
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016361   Gene: ENSMODG00000011478   Transcript: ENSMODT00000016663
Sequence length 135
Comment pep:novel chromosome:BROADO5:1:713243977:713244617:1 gene:ENSMODG00000011478 transcript:ENSMODT00000016663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLSQLLFGLLMLWVPGSRGEVVLTQSAASVSVSPGERVTISCQASQSVKHSDGRTYLD
WIQQKPGQSPRLLIYQVSNLDSGIPARFSGSGADRDFTLTINSVSAEDGADYYCAQRSFY
PLTVLQARTKTSSEL
Download sequence
Identical sequences F7FBN9
ENSMODP00000016361 13616.ENSMODP00000016361 ENSMODP00000016361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]