SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016376 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016376
Domain Number 1 Region: 36-291
Classification Level Classification E-value
Superfamily L domain-like 6.8e-46
Family Ngr ectodomain-like 0.055
Further Details:      
 
Domain Number 2 Region: 284-379
Classification Level Classification E-value
Superfamily Immunoglobulin 6.91e-19
Family I set domains 0.02
Further Details:      
 
Domain Number 3 Region: 421-496
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000934
Family Fibronectin type III 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016376   Gene: ENSMODG00000013085   Transcript: ENSMODT00000016678
Sequence length 776
Comment pep:novel chromosome:BROADO5:1:282355255:282456305:1 gene:ENSMODG00000013085 transcript:ENSMODT00000016678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKLLFSLLFIGMAVRAQICPKRCVCQILSPNLATLCAKKGLLFVPPNIDRRTVELRLAD
NFVTNIKRKDFANMTSLVDLTLSRNTISFITPHAFADLRNLRALHLNSNRLTKITNDMFS
GLSNLHHLILNNNQLTLISSTAFDDVLALEELDLSYNNLENIPWEAVEKMVSLHTLSLDH
NMIDHIPKGTFSHLHKMTRLDVTSNKLQKLPPDPLFQRAQVLATSGIISPSTFALSFGGN
PLHCNCELLWLRRLSREDDLETCASPTLLSGRYFWSIPEEEFLCEPPLITRHTHEMRVLE
GQRATLRCKARGDPEPAIHWISPEGKLISNATRSLVYDNGTLDILITTVKDTGSFTCIAS
NPAGEATQTVDLHIIKLPHLLNSTNHIHEPDPGSSDISTSTKSGSNTSSSNGDTKMSQDK
KVVVAEATSSTALLKFNFQRNIPGIRMFQIQYNGTYDDSLVYRMIPPTSKTFLVNNLAAG
TVYDLCVLAIYDDGITSLTATRVVGCIQFTTEQDYVRCHFMQSQFLGGTMIIIIGGIIVA
SVLVFIIILMIRYKVCNNNGQHKVTKVSNVYSQTNGAQIQGCSGTMPQSVSKQAIGHDEN
IQCYKGPSENVIQSSDTCSSQDSSTTTSALPHTWTSSTSASQKQKRKMGPKPSNDPQNEA
VSSVESQNANRNNSTALQLVSRHPDSVKEVPTSKRAQSKSSKFLTVPAERSRARRRYSLN
GKLMEYHCYVKSENTGVLWSKRSISMNGMVIQSGNSDLDSGKATFSRSEWILESTV
Download sequence
Identical sequences F7FB54
ENSMODP00000016376 XP_007473289.1.35504 XP_016283532.1.35504 XP_016283533.1.35504 XP_016283534.1.35504 XP_016283535.1.35504 XP_016283536.1.35504 ENSMODP00000016376 13616.ENSMODP00000016376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]