SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016397 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016397
Domain Number 1 Region: 21-286
Classification Level Classification E-value
Superfamily L domain-like 2.98e-43
Family Ngr ectodomain-like 0.0044
Further Details:      
 
Domain Number 2 Region: 287-381
Classification Level Classification E-value
Superfamily Immunoglobulin 5.02e-17
Family I set domains 0.015
Further Details:      
 
Domain Number 3 Region: 429-504
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000216
Family Fibronectin type III 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016397   Gene: ENSMODG00000013102   Transcript: ENSMODT00000016699
Sequence length 800
Comment pep:novel chromosome:BROADO5:2:281926501:282069458:-1 gene:ENSMODG00000013102 transcript:ENSMODT00000016699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLLSSLLAFGMAFAVVDACPKYCVCQNLSESLGTLCPSKGLLFVPPDIDRRTVELRLG
GNFIIHISRQDFANMSGLVDLTLSRNTISYIQPFSFLDLESLRSLHLDSNRLPSIGEDTL
RGLVNLQHLIVNNNQLNHVADDAFEDFLLTLEDLDLSYNNLRGLPWDSVRRMVNLHQLSL
DHNLLDHIAEGTFADLQKLARLDLTSNRLQKLPPDPIFARSQASSLTATPFTPPLSLSFG
GNPLHCNCELLWLRRLDRDDDLETCGSPASLKGRYFWHVREEEFMCEPPLITQHTHKLLV
LEGQAATLKCKAIGDPSPLIHWVAPDDRLIGNTSRTAAYDNGTLDILITTSQDYGAFTCI
AANAAGEATATVEVSIVQLPHLSNGTSRTTSPKSRLSDITGSSKAGRGGGTGGGGGGGAG
AGEASKGPPERAVLVSDVTTTSALVKWSVSKSAPRVKMYQLQYNCSDDEVLIYRMIPASN
KAFVVNNLVSGTGYDLCVLAMWDDTATTLTATNIVGCAQFSTKADYPQCQSMHSQILGGT
MILVIGGIIVATLLVFIVILMVRYKVCNHQGPGKMNAAVSNVYSQTNGAQPPQPPPSNAV
QNGAPPQVHPKASMRNEFGNGSGTSGASGSSSSSSSLGSTDGAGSRGPWRLPPPSTRPKP
NLDRLMGAFASLDLKCQRKEEPLDSRTPAGTAATGRHSDREPLLGPPAARARSLLPLPLE
CKARRSHSFDMGDFTAAGAASGVSGGTVAQGGYSPPRRVTNIWTRRSLSVNGMLLQFEDN
DLVGPRGTYGSSEWVMESTV
Download sequence
Identical sequences F7EX89
ENSMODP00000016397 13616.ENSMODP00000016397 ENSMODP00000016397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]