SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016502 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016502
Domain Number 1 Region: 34-146
Classification Level Classification E-value
Superfamily Immunoglobulin 1.36e-16
Family V set domains (antibody variable domain-like) 0.0076
Further Details:      
 
Domain Number 2 Region: 258-331
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000185
Family I set domains 0.0066
Further Details:      
 
Domain Number 3 Region: 169-247
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000082
Family C1 set domains (antibody constant domain-like) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016502   Gene: ENSMODG00000013186   Transcript: ENSMODT00000016806
Sequence length 353
Comment pep:novel chromosome:BROADO5:4:229892145:229988394:1 gene:ENSMODG00000013186 transcript:ENSMODT00000016806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARMGHAVASGCWWAFALSLATLFLPGLQAQVVQVNDTVSGFIGTDVVLHCSFSNPLPMV
RITQMTWQKATNGSKQNVAIYNPNMGVSVLAPYRERVTFLRPSFTDGTIRLSHLELEDEG
VYICEFATFPTGNRESQLNLTVLAKPTNWMEVTKKILTAKTGQTEKVLVATCISANGKPP
STVSWDTRLKGEAEFQEIRHPNGTVTVISRYRLVPSREAHKQPLACVVNYQLDRFSDSIT
LNVQYEPEVTIEGFDGNWYLKRMDVKLTCQCDANPPVTHYQWKMLNGTLPSSMDTQNKTL
FFKGPVTYSLSGTYICEATNPIGTRSGMVEVNITGRKLMTALPTSPVPTSLLF
Download sequence
Identical sequences F7FAD9
ENSMODP00000016502 ENSMODP00000016502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]