SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016504 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016504
Domain Number 1 Region: 30-112
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000261
Family V set domains (antibody variable domain-like) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016504   Gene: ENSMODG00000013188   Transcript: ENSMODT00000016808
Sequence length 162
Comment pep:novel chromosome:BROADO5:4:230374336:230375947:1 gene:ENSMODG00000013188 transcript:ENSMODT00000016808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSPKIAIAVLLTVLQVAYGQKVNSLTACLVDKTLRVDCRFDNTSKTPLQYEFSLTREKQ
RHVLNSTMGVPEHAYRSRVNLTISQNYMALFLKDFSQKDEGIYACDLRASGIPNSFTTKN
ITVYKDKLQTCGVMSLLVQNTSWLLLLLLSVPLLQATNFECL
Download sequence
Identical sequences F7FAD2
ENSMODP00000016504 13616.ENSMODP00000016504 XP_001380456.1.35504 XP_007494703.1.35504 ENSMODP00000016504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]