SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016550 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016550
Domain Number 1 Region: 429-523
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000249
Family I set domains 0.02
Further Details:      
 
Domain Number 2 Region: 249-322
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000251
Family I set domains 0.02
Further Details:      
 
Domain Number 3 Region: 344-408
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000787
Family V set domains (antibody variable domain-like) 0.071
Further Details:      
 
Domain Number 4 Region: 30-139
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000155
Family V set domains (antibody variable domain-like) 0.023
Further Details:      
 
Domain Number 5 Region: 157-226
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000131
Family C2 set domains 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016550   Gene: ENSMODG00000013229   Transcript: ENSMODT00000016855
Sequence length 642
Comment pep:novel chromosome:BROADO5:4:230606970:230626576:1 gene:ENSMODG00000013229 transcript:ENSMODT00000016855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLTLLLCALLLTAFCCRRSAGVPGEEEVIPEILEFQVGDNAHLSCDSSLPTDNRSNVDW
FFKHKDQLIPIFRVRQGQGQPDPGDYQHRLTLLGGANLSLAHVTPRDERIFICQVKAIGS
HTQEKHIQLRIYKAPKEPTIQASTSGISVTSKVLQEVATCNGEDGYPLPHITWYKNRTPL
KEEKNRIRFTESRTKESSGLYTVRSTLWAQLDKEDKEALFYCELSYRLPGGDHMKESKEV
NVTIYYPMEKVWLEVMPNRLLKEGDKVELKCLSDGNPPPDFTIRKQDPSSHDWLEVENTS
DAVLVLEQANRHHSGLYECLGLDFETGMEAIDQQQLLVNYVSNVQVQPRAPVTFEGNSLK
LNCSAESSQPVVFQWKREKTGEVLKNGSVLHLTNLTREAGGGYLCVASVPKVPGLKHTQL
VNVTINGSPWVMAKERHMWVKENEVVNLTCEISGKPRPTISWSVNGTVYEHDKDFQSILS
TLKVQVIPELLEKGVVCQASNSLGSNKTTILLELVNLTTPTVTTTENTTSSHGTTTNSPS
AKANGTSTGDQVKKAGTRQESKGVVIVAVIVCILLLAVLGAVLYFLYKKGKMPCGRSGKQ
EITLPLARKNEIVVEVKSDKLPEEMGLLQGSNGDKRSPRDQN
Download sequence
Identical sequences F7ECX9
ENSMODP00000016550 ENSMODP00000016550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]