SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016618 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016618
Domain Number 1 Region: 26-119
Classification Level Classification E-value
Superfamily Immunoglobulin 6.84e-21
Family I set domains 0.0019
Further Details:      
 
Domain Number 2 Region: 120-215
Classification Level Classification E-value
Superfamily Immunoglobulin 5.65e-20
Family I set domains 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016618   Gene: ENSMODG00000013289   Transcript: ENSMODT00000016923
Sequence length 295
Comment pep:novel chromosome:BROADO5:4:412448563:412455323:1 gene:ENSMODG00000013289 transcript:ENSMODT00000016923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGSLAALLCLGLCLSQSVKAYKERLPKPSLWAVPGPVIPWGKPTIIRCQGTEDAHKYVL
EKDGGMELRDMLEVAGPWKEAEFFISNTRAESGGQYRCQYSSKNVWSEFSDPLELTVTGL
YPKPSFSVIPVSILDPGEDVTFHCESQMASDKFIFYKTTGANAPHMLSSSDHGADFPILS
VTPSHGGTYQCYTFDDDYPYLWSIPSDIILLKVSDSQRRGSSDVDSDYDSVPQQLTFTSL
RLVIVGVTLAILGILLNEAWHSRAAAYNPKEKPKQPERQSELWMDGPIEDSPKRP
Download sequence
Identical sequences F7A9W9
ENSMODP00000016618 ENSMODP00000016618 XP_007492693.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]