SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016685 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016685
Domain Number 1 Region: 702-842
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.81e-35
Family MAM domain 0.00052
Further Details:      
 
Domain Number 2 Region: 207-300
Classification Level Classification E-value
Superfamily Immunoglobulin 5.91e-18
Family I set domains 0.006
Further Details:      
 
Domain Number 3 Region: 404-506
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000432
Family I set domains 0.022
Further Details:      
 
Domain Number 4 Region: 117-187
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000238
Family I set domains 0.024
Further Details:      
 
Domain Number 5 Region: 309-375
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000446
Family V set domains (antibody variable domain-like) 0.045
Further Details:      
 
Domain Number 6 Region: 163-209,584-685
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000315
Family Fibronectin type III 0.0078
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000016685
Domain Number - Region: 25-48
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0227
Family I set domains 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016685   Gene: ENSMODG00000013337   Transcript: ENSMODT00000016990
Sequence length 842
Comment pep:novel chromosome:BROADO5:2:277606356:277637874:-1 gene:ENSMODG00000013337 transcript:ENSMODT00000016990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APAQAQIVHAGQACVVKEDNISERVYTIREGDTLVLQCLVTGHPRPQVMPPSLLCTGSEA
SAHSCSYVEEEIKVGNVDRDSYSLGKEKPLGGPALPDLDEPVLTVHQTVSDVRGSFYQEK
TVFLRCTVNSNPPARFIWKRGSSTLSHSQDDGVDIYEPLYTQGETKVLKLKNLRPQDYAS
YTCQVSVRNVCGIPDKAITFRLTNTTAPPALKLSVNETLVVNPGENVTVHCFLTGGDPQP
QVLWSHGPGPLPLGSRAQGGTLTIPSVQAQDSGYYNCTAINNVGNPAKKTVNLLVRSMRN
ATFQITPDVIKESESIQLGQDLKLSCHVDAVPQEKVSYQWFKNGKLARVSDRLLVTRNDP
ELPAVTSSLELIDLRFTYRQRDVWEIWDGRLMKEALSSSSPFAVPPTISVPKGRSVVMVR
EGSSVELQCEVRGKPRPPVLWSRVDKEAGLLPSGAAMEETPDGKLRVERVSREMSGTYRC
QTARYNGFNVRSREAQVQLNVQFQPPAFLQCLSSPEFLHPHSLPQRSLTALCPLSSVPSS
LPCFLEFGNPLSLSVTSSSPSYILSTDLFPLPSCSQRFLLFLPTKAYSPEFYYDTPNPTR
SHKLSKNYSYVLQWTQKEPDAVDPVLSYRLDVRQLSLRTSITKPIPVRRVEKGQLLEYIL
TDLKVPHSYEVRLTPITTFGAGDMAARIIRYMEPTNSPNLSDNTCHFEDEKICGYTQDRA
DNFDWTRQNALTQNPKRSPNTGPPTDISGTPEGYYMFIETSRPRELGDRARLVSPLFNIS
AKLYCVSFFYHMYGKHIGSLNLLVRSRNKGALETHAWSLSGNRGNSWQQAHVPINPSGPF
QV
Download sequence
Identical sequences F7GAF9
13616.ENSMODP00000016685 ENSMODP00000016685 ENSMODP00000016685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]