SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016815 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016815
Domain Number 1 Region: 32-125
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000236
Family I set domains 0.05
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000016815
Domain Number - Region: 123-214
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0048
Family C1 set domains (antibody constant domain-like) 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016815   Gene: ENSMODG00000013448   Transcript: ENSMODT00000017127
Sequence length 361
Comment pep:novel chromosome:BROADO5:4:231499943:231506865:-1 gene:ENSMODG00000013448 transcript:ENSMODT00000017127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGVPPTPSPTALLALPKQLWGELAPQIDGQTWAERALRENERHAFTCQVEGGHDPPRLAW
YLDGQLQEANTSRLLSVGGEAFTGSTSTFTITAQRAQHELNCSLQDPDTRRVANASVILN
VQFKPEIAQVGAKYQEAQGPGLLVVLFALVRANPPANVTWIDRDGPVTVNTSDFLVLDAQ
SYPWLTNHTVQLQLHSLAQNLSVVASNGVGVTSSSLPAPGLLATQVEVPMLGIVVAGALA
LGTLVGFSTLVACLVCRKDKKTTGTSRRPSLLSSDSNNLKLNNVRLPRENMSLPSNLQLN
DLTPNSKGAKPTDGQIPQNTRRPDILDPENGVLFTSQGFVHLPMLGYIYRASSMSSDEIW
L
Download sequence
Identical sequences F7G9K5
ENSMODP00000016815 13616.ENSMODP00000016815 ENSMODP00000016815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]