SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016890 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016890
Domain Number 1 Region: 27-104
Classification Level Classification E-value
Superfamily Immunoglobulin 5.72e-20
Family I set domains 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016890   Gene: ENSMODG00000013500   Transcript: ENSMODT00000017203
Sequence length 180
Comment pep:novel chromosome:BROADO5:4:231719143:231725665:-1 gene:ENSMODG00000013500 transcript:ENSMODT00000017203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLASLILTIILIQGIVAQTDEVGKPVDLDDNQQDGTVLLTCNFQEVQTVEWIKEGMILK
ETKKTLNLGSIFEDPQNVFWCRNLTNTPKKKSSPLHVYYRMCQNCMKLDGVTLSGLILAE
IITLFLLAVGIYFIARQDGVWQSRASDKQTLLTNDQLYQPLRDREDDQYSHLQGSHPRKK
Download sequence
Identical sequences F7F8D9
ENSMODP00000016890 ENSMODP00000016890 XP_001380716.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]