SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016898 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016898
Domain Number 1 Region: 42-114
Classification Level Classification E-value
Superfamily Immunoglobulin 7.91e-22
Family I set domains 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016898   Gene: ENSMODG00000013506   Transcript: ENSMODT00000017211
Sequence length 190
Comment pep:novel chromosome:BROADO5:4:231728025:231744740:1 gene:ENSMODG00000013506 transcript:ENSMODT00000017211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALQKIPRWTMKWDLCLTGLILTIILLQGSDVQADEEDKPLSISVVESEDKIFLKCNGTE
FSWMDLEESSNKSHLGNKSVDLGKKIQDPRGIYQCSDNKDKKSVLQVYYRMCQNCVEVKS
SSLIGILIADIIATVFLAVGVYCFAGHEEGYLSADFDKQILMQNDELYQPLRDRDDNSYS
HIGGKRPQNK
Download sequence
Identical sequences F7F8B6
ENSMODP00000016898 XP_007494772.1.35504 ENSMODP00000016898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]