SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016910 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016910
Domain Number 1 Region: 37-90
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000328
Family I set domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016910   Gene: ENSMODG00000013514   Transcript: ENSMODT00000017223
Sequence length 193
Comment pep:novel chromosome:BROADO5:4:231755656:231765523:-1 gene:ENSMODG00000013514 transcript:ENSMODT00000017223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLGSLWTVLGFFLLSACVWGEDLEEDPQKYKFGVSISGTQVTLTCPEKSEDLIIWKKNN
VLINGVESYQLTLDDSETEYSGHFHCKKKSSPSDEGYFLYLKARVCHGCLEMGVLTVAGI
IIADVFITLGVLILVYHWSKKQKAKSKPVRGGGAGGKTRGVNKESPPPVPNPDYEPIRKG
QRELYAGLNQRAM
Download sequence
Identical sequences F7D784
ENSMODP00000016910 ENSMODP00000016910 XP_001380727.2.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]