SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016929 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016929
Domain Number 1 Region: 32-131
Classification Level Classification E-value
Superfamily Immunoglobulin 3.13e-21
Family V set domains (antibody variable domain-like) 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016929   Gene: ENSMODG00000013532   Transcript: ENSMODT00000017242
Sequence length 195
Comment pep:novel chromosome:BROADO5:4:231822466:231828222:1 gene:ENSMODG00000013532 transcript:ENSMODT00000017242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYGKSPTCAVLLFCIQLAVVWHIAAVEVYTSRVVEAVNGTDLRLKCTFSSFSPVGNALTV
TWNFRPRDGGAEEFVFYFHEQPYPPTAGRFKNRVVWDGNVNRNDVSIIIWKLQFNDNGTF
TCQVKNPPDVDGVIGETRLSVVQTVRFSEIYFLALAIGSACALMVLIVIVVVLFQHSRKR
RWAHRGHVAVETEST
Download sequence
Identical sequences F7D6J6
ENSMODP00000016929 XP_003341348.1.35504 XP_007494773.1.35504 ENSMODP00000016929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]