SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016932 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016932
Domain Number 1 Region: 39-136
Classification Level Classification E-value
Superfamily Immunoglobulin 1.15e-19
Family V set domains (antibody variable domain-like) 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016932   Gene: ENSMODG00000013534   Transcript: ENSMODT00000017245
Sequence length 235
Comment pep:novel chromosome:BROADO5:4:231828794:231863235:1 gene:ENSMODG00000013534 transcript:ENSMODT00000017245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPISLAGGCCRAFSRLLSFLLFQGLYAVLSMEIKADAHVRGYIGESIKLKCTFRSSSPV
SDKLTIDWTYRQPTSSRIEPIFHYQSFQYPTTAGTFRDRISWVGDVYRGDASISISNPTM
RDNGTFSCSVKNPPDVHHNIPMTELVVTERGFAIQLSSAALLSILVFIPSAVVVTLLLVR
MGRKSAGLKKKSKSGYKKSSIEVSDDTDQGEDEDCMRRFCTRCAECLDSDYEEAY
Download sequence
Identical sequences F7CMM7
ENSMODP00000016932 ENSMODP00000016932 XP_007494774.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]