SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016948 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016948
Domain Number 1 Region: 35-139
Classification Level Classification E-value
Superfamily Immunoglobulin 4.36e-18
Family V set domains (antibody variable domain-like) 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016948   Gene: ENSMODG00000013543   Transcript: ENSMODT00000017261
Sequence length 215
Comment pep:novel chromosome:BROADO5:4:231913505:231926582:1 gene:ENSMODG00000013543 transcript:ENSMODT00000017261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRDAWLPRPSFCFTGLSLFFSLVPSASSMEVTVPLNLNVLNGTTVRLACTFNSCYTVNN
KQFSLNWTYQECGNCTEEMFLQFRMKIINLKPNRFGDRVEFTGNPSKYDVSVTLNNVQLE
DEGTYNCYVMNPPDRNRGQGKIYLQVLTQVPPERDSTVAVIVGASVGGFLAVIILALMVV
KCVRRKQEQKLNADDLKTEEECKTDGEGNPEDGTK
Download sequence
Identical sequences F7CLU2
ENSMODP00000016948 13616.ENSMODP00000016948 XP_001370725.1.35504 ENSMODP00000016948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]