SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016950 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016950
Domain Number 1 Region: 42-153
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000566
Family V set domains (antibody variable domain-like) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016950   Gene: ENSMODG00000013544   Transcript: ENSMODT00000017263
Sequence length 230
Comment pep:novel chromosome:BROADO5:4:231938941:231969994:1 gene:ENSMODG00000013544 transcript:ENSMODT00000017263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEAGYQVPAAARWLGSGLLGIALLLFPWSLALEVSVGKATTITAVNGSDVLLPCTFSTC
MGFENLHFWWTFNSTEEYKNLLDGTVKNEKSEPKIRSNIDPRIELAGSVKEKKNNISILI
HFLEFSDKGKYTCRVKNPKEKNAQHEATISLIVVEKLVEVDNTVTIIIVSVVGGLIGFLI
VFMLIKKFITFIIKKTQEKKKECLVNSSGNDNTENGMAGSKAEQKATPKL
Download sequence
Identical sequences F7C3M7
ENSMODP00000016950 ENSMODP00000016950 XP_007494777.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]