SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016957 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016957
Domain Number 1 Region: 83-269
Classification Level Classification E-value
Superfamily vWA-like 4.08e-29
Family Integrin A (or I) domain 0.0064
Further Details:      
 
Domain Number 2 Region: 1874-1931
Classification Level Classification E-value
Superfamily BPTI-like 8.23e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0012
Further Details:      
 
Domain Number 3 Region: 2-74
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000638
Family Fibronectin type III 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016957   Gene: ENSMODG00000013552   Transcript: ENSMODT00000017271
Sequence length 1943
Comment pep:novel chromosome:BROADO5:6:201087897:201126653:-1 gene:ENSMODG00000013552 transcript:ENSMODT00000017271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSVTLAWTPVPGASSYILSWRPLPGSGYTAPGSQQTLPGSLHSQKVTGLEPGVSYTFSL
TPVQGSSRGPEASLTHHLGCSHGRADVVFLVHATRDNEHHSGVVKSALSRLVSALGPLGP
DAMQVGLMAYSHRPSPLVPLNGSYDRNSILQRIQGIPYTDPSGNNLGVAITTAYRYLLAP
GSSGRRSHVPGLLVLVVDGPSGDDAISPAREAQAAGLSVLVLGMPGAQPEQLRRLVSGVD
PAPVFMAVDNARSLEQAVGGLATALCQAASGTQPRPAPCPSQCPKGQKGEPGATGQKGQA
GPPGDPGRSGPPGPRGLPGGGEKGERGFPGVDGRPGSPGNPGSPGVTGSPGRPGSRGEAG
EPGLPGQKGEPGKPGSVTGGGAGLPGKKGEPGVQGPPGPRGSDGDPGLPGPRGTSIKGLP
GPGSGGVGGGDPGLPGLPGNPGPMGPPGPRGEKGDKGEGEDGFPGLPGRQGNPGDRGPRG
PPGEPGSKGDPGQPGSLGEAGEKGDRGFPGPPGLQGEPGLSGRPGAEGPEGPPGPVGRRG
EKGEPGEPGKPGEGLDGAGVKGEKGNLGPEGPQGAPGPKGDRGLPGVGVPGDPGPKGELG
DRGAIGLTGRAGPKGEVGASGDKGEPGRPGPPGPIGPRGRDGETGEKGDEGPVGETGLPG
KPGDRGLRGIPGIRGPPGEKGDQGDPGEDGRNGSPGLTGPKGDRGEPGPPGPPGRPVRAG
EKGTKAGDPGEDGARGPKGDAGPPGSPGERGTEGLRGPPGPRGEPGDRGPAGEKGERGTP
GSDGRNGLDGKPGAIGPPGLRGDTGKTGEPGRDGLPGLRGEHGPPGPPGLPGVTGKPGDD
GKPGLNGKNGEPGDPGEDGRKGDKGEAGSPGRDGRDGSKGDRGDVGTPGLQGPPGLPGPV
GPPGQGFPGVAGSPGPKGDRGEAGARGEQGLPGERGLKGESGSVMNLEQSLESLGIKVST
LRQIVREGAEDFHGFPDRFRGQKGEPGERGPMGKEARGPVGLTGERGSKGDRGDTGPQGP
PGHAHIERGPSGPPGQPGEPGKPGIPGLPGRAGELGEAGRPGERGERGEKGERGEQGRDG
LPGPPGPPGPKVDMEGTISGISGEPGPPGLRGAKGEPGRDGERGPKGDKGEYGAKGDRGE
AGEKGRDGSPGPSGERGPSGLEGKPGPQGARGAPGPAGNQGDPGPHGVPGLAGPPGPQGP
SGLKGEPGEPGPPGRGLPGPPGVMGLSGPPGSSGLVGPQGAPGLPGQVGETGKPGVTGRD
GKDGERGAPGVPGPPGLSGPVGPKGEPGATGLPGQAVVGPPGMKGEKGAPGGLAGDLVGE
PGSKGDRGLPGPRGEKGEAGQPGEPGDPGEDGRKGAAGLRGEKGSMGVGIQGPPGSDGPP
GLKGDSGLPGPPGPPGAPGVVGFPGHAGPRGEPGQPGPSGERGLMGPPGKEGAPGPSGLP
GPTGPAGAPGASGPKGDKGDPGVGQPGARGERGDPGIRGENGRPGLEGDRGPAGPPGNRG
ERGDKASMSPGLKGDKGDTAVIEGPPGPRGPKGEAGDRGLRGLDGDKGARGELGLPGEKG
VKGELGDKGSAGSQGVRGPMGQKGESGDPGIPGASGLSGKDGVPGIPGEKGEAGYMGPRG
PKGDRGLKGACGQDGEKGDKGEAGLHGRPGIPGRKGDMGEMGLPGLSGHPGKEGLIGPKG
DRGFDGQQGSKGDQGEKGERGAPGVGGIQGPRGSDGASGPPGPPGSVGPKGPEGIQGQKG
ERGPPGESVVGTRGAPGIPGERGEQGSIGPMGPRGEKGEASMTESDIRSFIRQEMSQHCA
CGTGQFISSGSRPLPSYSADTPGPGPWPRPVPVLRLSHAEEEGPGPPEDDEYSLEDYEDA
EEPWAGHGETFPPHPPQSVCSLPMDEGSCSDYTLRWYHRPGKGCHPFVFGGCEGNANRFS
SREDCERQCLPHGGPGAPAVSQS
Download sequence
Identical sequences F7C3E6
ENSMODP00000016957 ENSMODP00000016957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]