SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016964 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016964
Domain Number 1 Region: 174-416
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.73e-80
Family Eukaryotic proteases 0.00011
Further Details:      
 
Domain Number 2 Region: 80-181
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000288
Family Hepsin, N-terminal domain 0.055
Further Details:      
 
Domain Number 3 Region: 33-69
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000432
Family LDL receptor-like module 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016964   Gene: ENSMODG00000013560   Transcript: ENSMODT00000017278
Sequence length 418
Comment pep:novel chromosome:BROADO5:4:231987926:232076164:-1 gene:ENSMODG00000013560 transcript:ENSMODT00000017278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFSKKELLQFFFTFMLFLLTFHCGILLSFLILSRHYFFCSTSYQIIKKSKVCDKQKNCI
FGEDEKHCVESISNYENMPLVGVRLSKDRSTLQVIHRETQLWFSVCFDNFLEAWAEIACS
EMGYNRTGTNPVFQAVKIGPKQQFPVSHIIAIDQELQVWDFSRPCLSMALVALHCTDCGG
SLYSSRVVGGHESSVKSWPWQVSIQYKKSHICGGSILDHYWILTASHCFRISSVVSLWKV
KVGIHYLYARTPYLDLDKIFIVKRNIFNSLSNDLALIKLKRPLVMSDRVSPICLPFFDED
LAPSTSLWIVGWGFKNEKEERFSAVLQQAKVQLIDRNKCNENDAYFGAVSGSMLCAGSPD
GFLDTCQGDSGGPLMYYKEKWQIVGIVSWGIGCGQPNFPSVYTRVNFFLNWIYNIRKK
Download sequence
Identical sequences F7C2Y2
ENSMODP00000016964 ENSMODP00000016964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]