SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016971 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016971
Domain Number 1 Region: 47-139
Classification Level Classification E-value
Superfamily Fibronectin type III 3.17e-26
Family Fibronectin type III 0.00017
Further Details:      
 
Domain Number 2 Region: 146-252
Classification Level Classification E-value
Superfamily Fibronectin type III 4.07e-19
Family Fibronectin type III 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016971   Gene: ENSMODG00000013564   Transcript: ENSMODT00000017285
Sequence length 605
Comment pep:novel chromosome:BROADO5:4:232184782:232202749:-1 gene:ENSMODG00000013564 transcript:ENSMODT00000017285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPWLVAWMASLFLLSCLLISGAAASGETPWTTSAPELPAPSPPREAQLPSPQNVQFKA
ILFYHILHWEPGQNQTQNIVYEVQYKRYGDSWKTVPNCTRIPHLTCDLTLPTLDLEDNTY
WARVRAIAGHQMSKWTRTDGRFAKEDVILRIDHLKLQLSGNTILGEILPARPPLANGNIS
YESLFKHYREYELCITNVLENDTSCQKSWKINSQKFLLPVPEAGMICIKVKPVIRSSINE
GLWSEKKCITVTKPYLTVTTISIFFASLLTVCIAVCYLSIRLYLRKPKKPPEVLLSLTKQ
RSCGILSKESFKVKQDIICPLDEATFPKVSLELKNSELHSSTDSGFSSTKQSLQSEDPQF
LLPVLEPITSGTSEERSPHQPKSDLSTSSTSTSSTDSGIYLHNPNPQTGQEWRQQPGTGD
QGQEDSGIGLPQSAIATPLGSSHGLQYNRGSTALEGNSSPSKLPEEEAEASVAFQGYLQQ
SRCTKKSQEETTSLGEDPSHIGSPGYKCRTHRDVELGWPPLAQTKGYLKQNSAGQSLGIL
EALPNQWIEPAEEWSLLSLANNGDLKTFDMPDLPLLSFPTAPTTPGNLNSDLLTLPLISS
LHTNE
Download sequence
Identical sequences F7BIG7
ENSMODP00000016971 ENSMODP00000016971 XP_007494784.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]