SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016975 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016975
Domain Number 1 Region: 255-497
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.04e-75
Family Eukaryotic proteases 0.0000455
Further Details:      
 
Domain Number 2 Region: 165-262
Classification Level Classification E-value
Superfamily SRCR-like 1.31e-18
Family Hepsin, N-terminal domain 0.049
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000016975
Domain Number - Region: 144-168
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000131
Family LDL receptor-like module 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016975   Gene: ENSMODG00000013569   Transcript: ENSMODT00000017289
Sequence length 506
Comment pep:novel chromosome:BROADO5:4:232275163:232324779:1 gene:ENSMODG00000013569 transcript:ENSMODT00000017289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGNNYTNVLPSRASSTRSTSITSSPIRSTSITSSPIRSSSTRSTSITSPASSSPASASP
IRLVRSSPVRSAVRPTPTRSSPATRAASESRSVSMPKITWQGSQKRLTLIGCILLLIALV
IALILLFYFWKGHTAIKYREPIESCHRNAVRCDGVVDCKLKSDELGCVRFDWDKSLLRVY
SGVHRQWLPICSAGWNNSYSEKICRQLGFQSAHHTGEITHQEYTSSYVVSEYNNTIQESI
NRSDCPSHQFVSLQCTRCGMRVMTGRIVGGALAPENKWPWQVSLHFGTTHICGGTLIDAQ
WVLTAAHCFFVTREKILEGWKVYAGTTNLFHLPEAASVSQIIINSNYTDEEDDYDIALVR
LDKPLTLSGDVHPACLPMHGQTFSLNETCWITGFGKTKETDGKEPELLIRDLWVNLEKQK
KPPGRWGSASQRASGGRPRGGRDSCQGDSGGPLVCEKNNRWYLTGVTSWGTGCGQRNKPG
VYTKVTEVLHWIYSKMEVREVGLSGD
Download sequence
Identical sequences F7BID7
ENSMODP00000016975 ENSMODP00000016975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]