SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017010 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017010
Domain Number 1 Region: 17-105
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000559
Family I set domains 0.023
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000017010
Domain Number - Region: 85-153
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00426
Family I set domains 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017010   Gene: ENSMODG00000013598   Transcript: ENSMODT00000017325
Sequence length 155
Comment pep:novel chromosome:BROADO5:4:232698758:232734961:1 gene:ENSMODG00000013598 transcript:ENSMODT00000017325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARPEDVGTSLYFVNDSLQQVTFSSSVGVVVPCPATGSPSAVLRWYLATGDDIYDVPHIRH
VHANGTLQLYPFSPSAFNSFIHDNDYFCTAENAAGKIRSPNIRVKAVFREPYTVRVEDQR
SMRGNVAVFKCLIPSSVQEYVSVVSWEKDTVSIIP
Download sequence
Identical sequences F6VVM8
ENSMODP00000017010 ENSMODP00000017010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]