SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017046 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017046
Domain Number 1 Region: 341-515
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-48
Family SPRY domain 0.0000367
Further Details:      
 
Domain Number 2 Region: 28-140
Classification Level Classification E-value
Superfamily Immunoglobulin 1.64e-19
Family V set domains (antibody variable domain-like) 0.00013
Further Details:      
 
Domain Number 3 Region: 154-229
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000124
Family C1 set domains (antibody constant domain-like) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017046   Gene: ENSMODG00000013624   Transcript: ENSMODT00000017362
Sequence length 528
Comment pep:novel chromosome:BROADO5:2:268675089:268683159:1 gene:ENSMODG00000013624 transcript:ENSMODT00000017362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFLSSLLFICLMFLFSLQMPVRGTEQFVVLGPTEPIVALLGTDIILPCRLSPLMSAEHM
EVRWFRSQFSEAVFVFQKGKEETEEQLVEYTGRTELISEFITEGRLAVKIYNVQISDNGK
YQCYFRKGDVYEQASLEVKVAGLGSAPHLRLEGHEDGGVKLACMADGWFPQPQVQWRDNR
GGKLSSLSETQAQDEAGFFHVKALIVVQESSVRNVSCSICNKLLSQEKISAIDIPESFFP
KTSPWKKALSGILPVVGILLGVSIFFIMKERKKVKKLLQKNKEEQKAKALQMKAAPVQRG
ICGRDSFGRGWEPVRQATAQLLLKALIGLSVHAFSCTCIDLVSLSAVNVTLDPASARPGL
VLSRNGKVMRVENAGKSAEETFGVLGREPITSGRHYWEVKVEMEAQNKATWYLGICREGV
SRSGWVRESSEEGFWIIGCYDGTFQPIVSKQSAAPSLGKPPEQIGIFLDCEAGDVSFYNM
TDGSHIYNFPRASFSGPVRPYFSIQTLDTSFTICGVSDRPESIPAPSL
Download sequence
Identical sequences F6UWR8
ENSMODP00000017046 ENSMODP00000017046 13616.ENSMODP00000017046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]