SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017073 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017073
Domain Number 1 Region: 28-194
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 7.66e-39
Family MHC antigen-recognition domain 0.00000296
Further Details:      
 
Domain Number 2 Region: 212-292
Classification Level Classification E-value
Superfamily Immunoglobulin 6.61e-18
Family C1 set domains (antibody constant domain-like) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017073   Gene: ENSMODG00000013649   Transcript: ENSMODT00000017389
Sequence length 352
Comment pep:novel chromosome:BROADO5:4:412809791:412955764:-1 gene:ENSMODG00000013649 transcript:ENSMODT00000017389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSASPSPQGLPLRLALFLPLLRVLSAGTPSLFYQLTAVAAAPPGTPSFWASGWLGPQLF
LTYSSGGSAEPWGAWRWEHQEAWFWEKETWYLKTQERLLQEALRLSKGAQTFQGLVGCQL
NPNNSAYPTSRFALDGMDFLTFDPVARDWLGNSEGAQAVRRHWANETHRADREAQFLLTT
CPEKLRSHLQNGKGNFQWKGMPPRCELEATPGQGQSTLTCQAFSFFPPEVKLTFLREGKP
VPEPEKGAEPWPNRDGAFHSQATLQVQRGDEARYSCEVRHPALATPLTVSFEASGLSLAV
IGGLVAACLLILLPIAAVVALVMWKKRGRPAPWIFRGRAADDVGALLSAPGP
Download sequence
Identical sequences F6UD96
ENSMODP00000017073 ENSMODP00000017073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]