SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017082 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017082
Domain Number 1 Region: 460-663
Classification Level Classification E-value
Superfamily Fibronectin type III 5.08e-42
Family Fibronectin type III 0.00000151
Further Details:      
 
Domain Number 2 Region: 619-704,808-854
Classification Level Classification E-value
Superfamily Fibronectin type III 4.99e-26
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 3 Region: 961-1122
Classification Level Classification E-value
Superfamily Fibronectin type III 1.08e-20
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 4 Region: 256-359
Classification Level Classification E-value
Superfamily Immunoglobulin 1.68e-20
Family I set domains 0.022
Further Details:      
 
Domain Number 5 Region: 166-266
Classification Level Classification E-value
Superfamily Immunoglobulin 4.16e-20
Family I set domains 0.022
Further Details:      
 
Domain Number 6 Region: 855-948
Classification Level Classification E-value
Superfamily Immunoglobulin 1.96e-17
Family I set domains 0.018
Further Details:      
 
Domain Number 7 Region: 361-464
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000205
Family I set domains 0.037
Further Details:      
 
Domain Number 8 Region: 82-172
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000218
Family I set domains 0.058
Further Details:      
 
Domain Number 9 Region: 2-81
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000514
Family I set domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017082   Gene: ENSMODG00000013655   Transcript: ENSMODT00000017398
Sequence length 1617
Comment pep:novel chromosome:BROADO5:4:233070362:233205640:1 gene:ENSMODG00000013655 transcript:ENSMODT00000017398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCAAKGAPPPTVTWALDDEPIQRDGGHRTNQYTMSDGTTISHMNVTAPQIRDGGVYRCAA
RNSVGSAEYQARINVRGPPSIRAMKNITAVAGRDTLINCRVIGYPYYSIKWYKDTLLLPD
NHRQVVFENGTLKLMDVQKGMDEGEYLCSVLIQPQLSISQSVHVAVKVPPLIQPFEFPPA
SIGQLLYIPCVVSSGDMPIRITWRKDGQVIISGSGVTIESKEFMSSLQISSVSLKHNGNY
TCIASNDAATVSRERQLIVRVPPRFVVQPNNQDGIYGKAGVLNCSVDGYPPPKVMWKHAK
GSGNPQQYHPVPLTGRIQILPNSSLLIRHVLEEDIGYYLCQASNGVGTDISKSMFLTVKI
PAMITSHPNTTIAIKGHTKELNCTARGERPIIIRWEKGDTVIDPDRVMRYAITTKDNGDE
VISTLKLKPADRGDSVFFSCHAINSYGEDRGLIQLTVQEPPDPPELEIREVKARSMNLRW
TQRFDGNSIITGFDIEYKNKSDSWDFKQSTRNISPTINQANIVDLHPASVYSIRMYSFNK
IGRSEPSKELTISTEEAAPDGPPMDVTLQPVTSQSIQVTWKAPKKELQNGVIRGYQIGYR
ENSPGSNGQYSIVEMKATGDSEVYTLDNLKKFAQYGVVVQAFNRAGTGPSSSEINATTLE
DVPSQPPENVRALSITSDVAVISWSEPPRSTLNGVLKGYRVIFWSLYMDGGKNSGCCLLQ
SDPHFSLGGKERIIQVHNPCSVPFSIPGGDEVIIRKWKTVHSRSSYTNLKTRPSGNVCWV
LYTVIVGIMAKKIQSEQHPTTTLISEYETSPEQLFYRIAHLNRGQQYMLWVAAVTSAGRG
NISEKVTIEPAGKAPAKIISFGGTVTTPWMKDVRLPCTSVGEPVPAIKWTKDSEDSAIAV
TVDGHRLIQTNGTLVLRSVKAEDSGYYTCTATNTWGFDTIIINLLVQDCDWRIKGKRKNL
ASSITLAWIAGDNGAGTIRGFVLQYSVDNSEEWKDVFISSSERSFKLDSLKCGTWYKVKL
AAKNSVGAGRISEIIEAKTHGREPSFSKDQHLFTHINSTHARLNLDWSSGGCPITSILLE
YRPKATWAWQGFEVNNSGEVFLAELREATWYELRMRACSAGCGNETTQFATLDYDGSTIP
PIKSAQGEGDDVKKLFSIACPVILATLGVALLIIIRKKRKEKRLKRLRDAKSLAEMLISK
SNRSLDTPVKGPPQGPRLHIDIPRVQLLIEDKEGIKQLGDDKATIPVTDSEFSQAVNPQS
FCTGVSLHHPALIQNTGPLIDMSDIRPGTNPVSRKNVKSAHSTRNRYSSQWTLTKCQAST
PARTLTSDWRTVGSQHGITVTESDSYSASLSQDTDKGRNSMVSTESASSTYEELARAYEH
AKLEEQLQHAKFEITECFISDSSSDQMTTGTNENADSMTSMSTPSEPGICRFTASPPKPQ
DSDRGKNVAVPIPHRANKSEYCNLPLYVKSDTFFRKADGHEPCPVVPPREASIRNMARTY
HTQARHLTLDPASKPLGLPHPGAPASTATLPQRTLAMPGPPTGAAPPPPAAPPVEPPPAA
ATTATAPPAPSTEPPRAGGPHTKMGGSRDSLLEMSASGVGRSQKQGAGAYSKSYTLV
Download sequence
Identical sequences F6TY02
ENSMODP00000017082 ENSMODP00000017082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]