SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017173 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017173
Domain Number 1 Region: 102-397
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.32e-74
Family Protein kinases, catalytic subunit 0.00000585
Further Details:      
 
Domain Number 2 Region: 1585-1863
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.87e-57
Family Protein kinases, catalytic subunit 0.0000507
Further Details:      
 
Domain Number 3 Region: 1366-1454
Classification Level Classification E-value
Superfamily Immunoglobulin 7.34e-22
Family I set domains 0.01
Further Details:      
 
Domain Number 4 Region: 4-90
Classification Level Classification E-value
Superfamily Immunoglobulin 1.32e-21
Family I set domains 0.0063
Further Details:      
 
Domain Number 5 Region: 1460-1553
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000143
Family Fibronectin type III 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017173   Gene: ENSMODG00000028220   Transcript: ENSMODT00000017492
Sequence length 1884
Comment pep:novel chromosome:BROADO5:6:199619386:199664300:1 gene:ENSMODG00000028220 transcript:ENSMODT00000017492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVTIEDIQAQAGETAKFQAIIEGHPLPIVTWYQGNTLLTNSPRVFQEQQGTNYSLVLKD
ITQQDAGIYTCVAQNPSGEVLCKAELLVQGGEAEMGAEKQSYRRKLHSFYEVKEEIGRGA
FGFVKRVEHKGNKVSCAAKFIPLRSKTRAQAYRERDLLATLNHRLVTQLLDEFETRKTLI
LILELCSSEELLDRLYKKNVVTETEVKVYIKQVLEGLKYLHDNDILHLDIKPPNILMVHP
TKEDIKICDFGFAQKIIPSEPQYSKFGAPEFVSPEIITQTPVTTTSDIWAVGVITYLSLT
CTSPFAGENDRATLLNVREGKISWTTPQAVHLSEEAKDFIKGILQLAPEARPSASKCLSH
PWFMKPSVPPEEAHFINTKQLKFIVARSRWQRSLMCYKSILVMQSIPELLQGPSDSPSLG
ISRHLIKEASYSTSSSSSDNEIAAYSRAKSLPPSPGSYSPVFQPRSLFQSSASLPEEGEL
PAGATGTPGGMDHRWEQSGKLSPRAPQRFWEQPLLPKTASADSRTLTEGETETGGVASFQ
EGDKTAAQGTTCVPRQSIIKSTFSWQAREAQEREGTSPVHDHRKHLERARRNLLKGWYSK
GALRGLREPLLEHYEMEEEEAKEGQIGPLTKSPSFETALRLPGSTSRISNRSHSFDDYRP
RTTSPFPELSEEKEQNKDQATGDTVGESPKMSQSESPGGTTIRLAPAKEQGITAGAISPS
QVASLPTSSSQKEEGSVLKARPPLPKSSGPRAADTCQEGHCPTSPVLHSQMASSSPWEDG
LKDGSLKSSNPFLFSDSTTTLHGGGHPLAPIPDAKVAPGLATEGKQADGSLKHSNPFFSG
SLLTTGSGPSAYTSDEGGHKDGSLKQSNPFLYSDMGSALQGGSQLTGIPADTLKRSNPFL
YHDPGSALLEGSSTWDATILQKQGIPSSTLPGTHMEGLLKTYSTLLPGQSQPTDSSKPSA
FETQTRLFTSSVSELHSFSEPVFLGNISPSEATSNLTSKSEYFYSATESASLEDVVEKMV
GLSKEMTILADSVSNQHGPKAQTVPRKFSYGERGGYVGIGGYGSFAFGGEGNVLGQRPLW
AARTWTESISSEEPEEMVQESTQAQTKSSSLTEIVETGKDAGKEIGKDARKETGKEKREE
TGKGSGEFLSWEEFGKSSQVSLVQIKDLSGDSSIGDTVSLDISEVEPAYLNLSDLYDIKY
LPFEFMIFRKVPKPVEEEVPAQMGVESIEKTDLEETWYKQEEFGLLPIRATGQQRSLEIM
EDFDPMELMGKDTKGHMYTSGKKRKSSPTKPGFFNFSGKYQPLESPVEHSLKKKVKASVA
HISRILKGKPAFEQERREVLEEEEAFKKKSGLSSFRLSGIKTKDRAPLFVKELTDEAVIL
GQSVTLSCQVSAHPAPQTEWFKDGIPIQTSGRLLISSTLKNFQLLTILVVTEEDLGVYNC
TVSNSLGMASTTGIIRKAEIPSSPPRPDIGEIYENGVLLVWKPVESHSPVTYIVQCKMEG
GDWITLASDIFDCCYYANNLSHGGMYSFRTACVSKAGMGPYSSSSEHIHIGDHNQMGPAI
IPDVFPGASKEKNGKVIQTQALSSQQTYAFQMEIRRGRFSVVRQCREKSSGRIMAAKIIP
YHPEDKLATLREYEVLKAIHHPNIAQLLGAYISPRHLVLILEFCPGPELLHCLAERTSYS
EMEVKDYLWQILSATEFLHAHRILHLDLRSENIVVTEYNLLKILDFGNAQFYTQDKVLPT
EKFKDYIETMAPELLEGHGAIPQTDVWAIGVTAFIMLSAEYPVSNEVTCDLQKGLRKGKI
KLNRCYAGLSGGAVAFLQSTLCANPWGRPCVSSCLQCPWLTKEGLEHTQQMSVTFSTNRL
KTFVKEREKKRALLYKKHNLAILH
Download sequence
Identical sequences F6X8C6
ENSMODP00000017173 ENSMODP00000017173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]