SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017211 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017211
Domain Number 1 Region: 5900-6019
Classification Level Classification E-value
Superfamily PH domain-like 2.43e-31
Family Pleckstrin-homology domain (PH domain) 0.00074
Further Details:      
 
Domain Number 2 Region: 5694-5890
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.68e-29
Family DBL homology domain (DH-domain) 0.00058
Further Details:      
 
Domain Number 3 Region: 10-100
Classification Level Classification E-value
Superfamily Immunoglobulin 4.45e-24
Family I set domains 0.0058
Further Details:      
 
Domain Number 4 Region: 6120-6213
Classification Level Classification E-value
Superfamily Immunoglobulin 1.22e-22
Family I set domains 0.0056
Further Details:      
 
Domain Number 5 Region: 5135-5228
Classification Level Classification E-value
Superfamily Immunoglobulin 1.45e-22
Family I set domains 0.0068
Further Details:      
 
Domain Number 6 Region: 4516-4619
Classification Level Classification E-value
Superfamily Fibronectin type III 2.64e-21
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 7 Region: 6022-6123
Classification Level Classification E-value
Superfamily Immunoglobulin 5.99e-21
Family I set domains 0.0039
Further Details:      
 
Domain Number 8 Region: 107-204
Classification Level Classification E-value
Superfamily Immunoglobulin 1.06e-20
Family I set domains 0.015
Further Details:      
 
Domain Number 9 Region: 4897-4989
Classification Level Classification E-value
Superfamily Immunoglobulin 1.67e-20
Family I set domains 0.0073
Further Details:      
 
Domain Number 10 Region: 255-345
Classification Level Classification E-value
Superfamily Immunoglobulin 4.88e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 11 Region: 5272-5368
Classification Level Classification E-value
Superfamily Immunoglobulin 1.66e-19
Family I set domains 0.0069
Further Details:      
 
Domain Number 12 Region: 2163-2256
Classification Level Classification E-value
Superfamily Immunoglobulin 1.98e-19
Family I set domains 0.012
Further Details:      
 
Domain Number 13 Region: 512-613
Classification Level Classification E-value
Superfamily Fibronectin type III 2.83e-19
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 14 Region: 3887-3980
Classification Level Classification E-value
Superfamily Immunoglobulin 3.53e-19
Family I set domains 0.015
Further Details:      
 
Domain Number 15 Region: 2477-2566
Classification Level Classification E-value
Superfamily Immunoglobulin 4.04e-19
Family I set domains 0.019
Further Details:      
 
Domain Number 16 Region: 2644-2737
Classification Level Classification E-value
Superfamily Immunoglobulin 2.42e-18
Family I set domains 0.02
Further Details:      
 
Domain Number 17 Region: 2287-2380
Classification Level Classification E-value
Superfamily Immunoglobulin 2.59e-18
Family I set domains 0.05
Further Details:      
 
Domain Number 18 Region: 2834-2922
Classification Level Classification E-value
Superfamily Immunoglobulin 3.21e-18
Family I set domains 0.0052
Further Details:      
 
Domain Number 19 Region: 5380-5480
Classification Level Classification E-value
Superfamily Immunoglobulin 4.93e-18
Family I set domains 0.0073
Further Details:      
 
Domain Number 20 Region: 1811-1899
Classification Level Classification E-value
Superfamily Immunoglobulin 1.29e-17
Family I set domains 0.058
Further Details:      
 
Domain Number 21 Region: 3093-3186
Classification Level Classification E-value
Superfamily Immunoglobulin 2.09e-17
Family I set domains 0.02
Further Details:      
 
Domain Number 22 Region: 3541-3630
Classification Level Classification E-value
Superfamily Immunoglobulin 2.68e-17
Family I set domains 0.02
Further Details:      
 
Domain Number 23 Region: 886-982
Classification Level Classification E-value
Superfamily Immunoglobulin 4e-17
Family I set domains 0.019
Further Details:      
 
Domain Number 24 Region: 1731-1819
Classification Level Classification E-value
Superfamily Immunoglobulin 8.39e-17
Family I set domains 0.018
Further Details:      
 
Domain Number 25 Region: 3976-4069
Classification Level Classification E-value
Superfamily Immunoglobulin 8.94e-17
Family I set domains 0.013
Further Details:      
 
Domain Number 26 Region: 1162-1259
Classification Level Classification E-value
Superfamily Immunoglobulin 9.08e-17
Family I set domains 0.011
Further Details:      
 
Domain Number 27 Region: 3718-3807
Classification Level Classification E-value
Superfamily Immunoglobulin 1.1e-16
Family I set domains 0.02
Further Details:      
 
Domain Number 28 Region: 3277-3366
Classification Level Classification E-value
Superfamily Immunoglobulin 1.85e-16
Family I set domains 0.024
Further Details:      
 
Domain Number 29 Region: 1070-1167
Classification Level Classification E-value
Superfamily Immunoglobulin 1.9e-16
Family I set domains 0.011
Further Details:      
 
Domain Number 30 Region: 1438-1535
Classification Level Classification E-value
Superfamily Immunoglobulin 2.06e-16
Family I set domains 0.011
Further Details:      
 
Domain Number 31 Region: 1254-1349
Classification Level Classification E-value
Superfamily Immunoglobulin 2.13e-16
Family I set domains 0.012
Further Details:      
 
Domain Number 32 Region: 3366-3455
Classification Level Classification E-value
Superfamily Immunoglobulin 2.15e-16
Family I set domains 0.03
Further Details:      
 
Domain Number 33 Region: 1530-1625
Classification Level Classification E-value
Superfamily Immunoglobulin 3.09e-16
Family I set domains 0.014
Further Details:      
 
Domain Number 34 Region: 3188-3278
Classification Level Classification E-value
Superfamily Immunoglobulin 4.43e-16
Family I set domains 0.036
Further Details:      
 
Domain Number 35 Region: 1362-1445
Classification Level Classification E-value
Superfamily Immunoglobulin 4.51e-16
Family I set domains 0.017
Further Details:      
 
Domain Number 36 Region: 3806-3892
Classification Level Classification E-value
Superfamily Immunoglobulin 5.52e-16
Family I set domains 0.015
Further Details:      
 
Domain Number 37 Region: 3447-3539
Classification Level Classification E-value
Superfamily Immunoglobulin 5.55e-16
Family I set domains 0.014
Further Details:      
 
Domain Number 38 Region: 995-1077
Classification Level Classification E-value
Superfamily Immunoglobulin 6.59e-16
Family I set domains 0.015
Further Details:      
 
Domain Number 39 Region: 335-427
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000157
Family I set domains 0.0083
Further Details:      
 
Domain Number 40 Region: 1641-1721
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000206
Family I set domains 0.02
Further Details:      
 
Domain Number 41 Region: 3632-3721
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000831
Family I set domains 0.015
Further Details:      
 
Domain Number 42 Region: 4634-4706
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000109
Family I set domains 0.031
Further Details:      
 
Domain Number 43 Region: 4242-4337
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000193
Family I set domains 0.019
Further Details:      
 
Domain Number 44 Region: 1985-2078
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000024
Family I set domains 0.015
Further Details:      
 
Domain Number 45 Region: 813-895
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000339
Family I set domains 0.038
Further Details:      
 
Domain Number 46 Region: 2913-3006
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000204
Family I set domains 0.021
Further Details:      
 
Domain Number 47 Region: 4424-4518
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000213
Family I set domains 0.0094
Further Details:      
 
Domain Number 48 Region: 2565-2657
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000366
Family I set domains 0.0074
Further Details:      
 
Domain Number 49 Region: 4161-4255
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000515
Family I set domains 0.012
Further Details:      
 
Domain Number 50 Region: 3012-3101
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000001
Family I set domains 0.012
Further Details:      
 
Domain Number 51 Region: 1906-1994
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000121
Family I set domains 0.051
Further Details:      
 
Domain Number 52 Region: 4333-4428
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000122
Family I set domains 0.024
Further Details:      
 
Domain Number 53 Region: 435-522
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000243
Family I set domains 0.017
Further Details:      
 
Domain Number 54 Region: 2743-2837
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000006
Family I set domains 0.019
Further Details:      
 
Domain Number 55 Region: 2088-2167
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000568
Family I set domains 0.0071
Further Details:      
 
Domain Number 56 Region: 704-789
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000126
Family I set domains 0.024
Further Details:      
 
Domain Number 57 Region: 2376-2469
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000365
Family I set domains 0.011
Further Details:      
 
Domain Number 58 Region: 5613-5675
Classification Level Classification E-value
Superfamily SH3-domain 0.000000793
Family SH3-domain 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000017211
Domain Number - Region: 625-711
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000144
Family I set domains 0.024
Further Details:      
 
Domain Number - Region: 4072-4117
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00289
Family I set domains 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017211   Gene: ENSMODG00000013764   Transcript: ENSMODT00000017530
Sequence length 6626
Comment pep:novel chromosome:BROADO5:6:199336681:199603090:1 gene:ENSMODG00000013764 transcript:ENSMODT00000017530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYNSFSGAPRFLTRPKAFLVSVGKDATLSCQIVGNPVPMVSWEKDQVPVASGGRFRMSE
EGDLYRLTIVDLTLEDSGQYMCRARNSIGEAFAAVSLHVGEDTMRAELAPYFLLRPTSIR
VSVGEDATFRCRVQGSPPMSVSWTKDGQRLGEPSSPDFHRVKVEARGEDSSLRIRGARPR
DGGTYTVLAENLIGSTSAAAALVVDEKSLLSPRAADASSGTTALLSHLQRRREEIRSEGT
NSSSSLGRWSSGGTRTCTVTEGKHARLSCFVTGEPKPETIWKKDGEVVVEGRRHMVYEDE
QENFVLKILYCKQEDNGLYTCTASNLVGQTYSSVLVVVREPTVPFKKRLHDLEVREKEAA
TFQCEVPLPATEASWYKEETRLRHSNKYNIEEEGTWRRLTVQNVTTDDDAVYICEMKEGS
RTIAELSVQGRSTRKLPRKTMVLTGDTAIFCVELAASADPIRWLRNQEEVKAGDRITITS
TGTCHTLTIKQCCQEDAGEVAFLAGECRTSTQFIVSAPRKPPPQAPYEPVVKAKMDSSVT
LGWSPPRLDRPIAIDGYLVERKKLGSQRWTRCHEMERISTLEVTVSSLMEAGDYQFRVAA
VNSFGQGPYLEFPGTIHLEPQLAVKTPLQAVEAVAGGEVTFTVDLTVASSGEWFLDGRAL
PVSDIYVIRCKGTQHSLTISPVPANLHGAQLKFVANGIESSIRMEVRAAPVRITNKSAAV
QKISARLHEEAQLLAELSDQADAVTWLKDGRALPSGPKYELQATEQRRVLRVRDVARDDA
GLYECLSHGDRIAYQLSVQDLVHFLHKDVAGGSVEAVLGGQAQFECETSEAHVIVRWYKD
GTELGRSQRLSQEDKGTKHSLVVGTVTRQDEGTYACRVGEDTLEFKLKVSEPSPIFAKEQ
QSQNKVQVTSGENATLSCEVAQSKTDVTWYKDGKKLSSSQRVRLEASSKSRQLVVQQAGQ
ADAGEYSCEAGGQRVTFHLNIQESVAVFAKEQQVQSKVEAVAGGSATLSCELAQAHTEVT
WYKDGKKLSRSQKVHVEAKGKSRQLVVQQAGKEDAGEYSCEAGGQRVTFRLDVKEPAMVF
AKEQQTQSKVEAVAGGSATLSCELAQAHTEVTWYKDGKKLSRSQKVHVEAKGKSRQLVVQ
QAGKEDAGEYSCEAGGQRVTFRLDVKEPAVVFAKEQQTQSKVEAVAGGSATLSCELAQAH
TEVTWYKDGKKLSRSQKVHVEAKGKSRQLVVQQAGKEDAGEYSCEAGGQRVTFRLDVKEP
AVVFAKEQQTQSKVEAVAGGSATLSCELAQAHTEVTWYKDGKKLSHSQKVHVEAKGKSRQ
LVVQQAGKEDAGEYSCEAGGQRVTFRLDIKESAVVFAKEQQTQSKVEAVAGGSATLSCEL
AQAHTEVTWYKDGKKLSRSQKVHVEAKGKSRQLVVQQAGKEDAGEYSCEAGGQRVTFRLD
VKEPAVVFAKEQQTQSKVEAVAGGSATLSCELAQAHTEVTWYKDGKKLSRSQKVHVEAKG
KSRQLVVQQAGKQDAGEYSCEAGGQRVTFRLDVKEPAVVFAKEQQTQSKVEAVAGGSATL
SCELAQAHTEVTWYKDGKKLSHSQKVHVEAKGKSRQLVVQQAGKEDAGEYSCEAGGQRVT
FRLDIKDSVVVFAKEQKIQNELQAVAGGSATLSCELAQAHTEVTWYKDGKKLSHSQKVHV
EAKGKSRQLVVQQAGKEDAGEYSCEAGGQRVTFRLDIQEPEAKTPEKPAKREPLVVQEHE
DIILSATVPSVTATVTWLKDGLEIRHSKRYELSSEGTTHTLTVHDAQTQDSAIYTCRANK
EKQDFTVQVEEVPVKFARPLEPVSGEVGQTVVLSCELSQALGDVAWRRGGMEIRSSKRFQ
MGTEGPRRTLTIVGLRAEDEGEYCCESRNDKTTTQLTAIVPRVAKFTSGLISAISEEGCE
ATFQCVVAPSDAMVVWRRNGVKLESGTKYVISQSDASHSLVITALTLEDAGQITAEAEGV
TTTANLKVREAPVLFKRKLEPMTVEEKGSATLEVELTKPCSSVRWTRNSATLVPSENVEI
RAEGTRHSLLLKNVSFSDRGFFGCETPDDKTQAKLNVEMRQIRLVRGLQAIEVREQGTVS
FEVELSHGDVEGSWTRDGLKLKSQDNCSITVQGVIHKLTLCSLGLEDAGLIAFKAEGVHT
SARLTVTELPIKFSHPLQDMVVTEKEKVTLECELSRANHDVKWLKDGVVLRVGKTLGIIS
LGTKRSLVIHKCEFGDQGTYVCDAGDAKTSATLQVQGTTYSLLYRKVMVEDAAEIKFVAE
NAESQAQLRVKELPVVIVRPLRDKIAMEKHRGVLECQMSRASAQVRWFKKDVELHAGPKY
EMVSDGIYRKLIINDAQPEDEDTYTCDAGDAKTSAHFYVEEQSITIVRNLKDMEVMEPAP
AWFECEISIPSVRPPKWLLGKTVLQAGRDVTIEQVETVHRLTLHRTCSTMTGPVHFTIGK
SKSTAQLIVSDIPVLLIRKMEDKTGREQQSVVLSCDFKPAPKAVQWYKDDTPLEPSEKYK
MKLENHMAELRILRLTPSDAGVYRCQAGNASSSATVTVEAREVAVVQPLQDVEATEEGSA
SFSCELSHEDEEVEWLLNGSLLYNDSFHEICHTGRRHTLVLKRVSLADAGTVSLKSAKVS
QSAQLTVKEKPVVFLKPLDDMAGEERGTLALECEVSHPKAQAIWRKDGVELGISDKYDIL
HTDRTRGLVIHDLSRDDAGLYTCDIGTDLTRSQVSVHELHIGITKRLKTTEVQEGDSCTL
ECILSHQSAGDVGTWTVNGKEVGGSGRFRASCQGRKYTLTLREAAMMDAGEVVFTVRDLT
SKASLIIKEKPAAITKPLEDQKVPPGEDVSLSCELSKAGATVRWLKDGKAIRKGPRYDLR
YEGSQAILVIRAASVKDSGEYTCETETSKSKAILIVEEKPNRFTKELMDVKGEEKGTAVF
ECETEKPAATVSWRKGITELQATRKHVPSQAGTALKLTISALDKGDSDTYTCDIGVAQSQ
AKLVVQGQKILITEDLEDVEVSEGSSATFRCRISPADYSPVQWFLDKTPLHTNELNDIDV
QPGGYHQLTVRQLALKDSGTIHFEAGDQRTSAALRVTEKPFLFSRELTDVTVTTGEPVTL
CCETTIEDHPVRWTKDGKALRPSAKYRISREGHEAKLVILSAGEQDGGRYECEFGKARTS
AIVRIQAAPIFFKEGLKAIEVSEGGATTLRCMLSAVAAPVEWRKGSEVIKSSNKYHLRQE
GASLELIVRDLKPEDSGEYSCVFKDQKTTATLTVKEIPVRFVVGLQSTESVEGTSTTLQC
ELSKAAPVEWKKGVKRLRASDRYRLRQDGALCELTIHSLDMDDTGDYTCACGEEKTTATL
TVKALPAKFLEGLESTEATEGATATLRCTLSKAAPVEWRKGLKRLRASDRYSLRQDGAMC
ELVIHKLDVDDSGDYTCVSGEAKTMATLTVKALPAQFIKGLKIMEATEGSMVALCCELSK
VAPVEWRKGPEKLQASDRYSLRQDGAVCELVIHRLDMDDAGDYTCVCGEEKTKATLTVKA
LPAKFMKVLQSTEATEGSIATLHCELSKAVPVEWRKGSKKLQASDRYSLRQDGAVCELVI
HRLDMDDAGDYTCVCGEEKTKATLTVKALPAKFMKILQSTEGTEGSLVTLHCELSKAAPV
EWRKGLEKLQASDRYSLRQDGAVCELVIHRLDTDDAGDYVCMCGEEKTTASLTVKALPAK
FIKVLQSTEATEGSLVTLHCELSKAAPVEWRKGPEKLQGSDRFSLRQDGTVCELVIHRLD
MDDAGDYVCVCGEEKTKATLTVKALPAKFTKVLKSTEAPEGSLVTLHCELSKAAPVEWRK
GPEKLQGSDRFSLRQDGTVCELVIHRLDMDDAGDYVCVCGEEKTKATLTVKAQTVVFRKP
LKSQQAEEGETATLRCELSKPDVPVIWSKGGLEVQASERVQVRQRGCISELLIHRLQLED
TGDYSCDCGDQTTSATLTVTALPVVFRKKLRAQDVEVGSTARLHCELSKENANVEWKKGA
VQLFPCAKYEMVLEGTVAELLIHDAEQEDTGDYTCDTGDQQTTASLTVNASKPKFKTRLH
SEELEEGTTARLHCELSVAQSSVEWRKESELLRPGSNSDLNSSKACDQFPFVLESLDTFI
CIEEGRLTVYGAKELEPEVTIVKGLTNMEVFADEDVEFCCEVSREQAGNVEWKLQGLALQ
NNEMNEISIVGGRTHTLRLRNVTPEDTGTISFSVGRHTSTAELIVKAPEVSIVEPLQDAK
LCEGDDAKFVCRLSRAPGQEVQWRLGGVPLQSNEMNEITAERGTVHTLTLRKVTVEDAGV
VSFHVGTSSSEAQLCVTAKNTIVRGLENVEAVEGGEALFECHLSKPEVANHSWLMDDVPV
RTSENIEMVYFENGRRHLLLLKNLTPQDSCRVTFLANDMVTSAFLTVKGWRLEFLESLLD
TEVKAGTKATFGCVLSETVPVNEVTWYINGAEIHPDKDWAIQADGSHHILLLRNAQPHHA
GEVTFAARDAVASAKLSVISLPDPPEDAEVVKQSGRSVTLSWAAPGSDGGAGLLGYKVEM
KTATGEWQPCYKDLVPGTECVVSDLVPGQPYRFRIAAVGQVGVGEPVHLPQTVKLGEWPS
SAFHAPVEAVASASISKMVVVGEEARLECEVAGEMQEVTWRKGNEVVQPGGRFELISKGK
KQTLVIHGFQPDDQGSYTCSSTSSKAPAATSFEEALSDGLAQPSLPPEAAQEGDLHLLWE
ALAKKRRMSREPTLDSISELPEEDERLQKLRREVEEAVQDFSEGYSTPDELARTGEADLS
HTSSDDESRAGTPSLVSYLKKAGKPGSKAKAPGTSPAGKPRKPWEQSEAEPAATPKLPGD
LTAELLEDPSMDKAAIKIQAAFKGYKVRKEMKQNEGPSFRDTFGDIAVEAGGSLHLECVA
VSKTDMRTSWLKDGVELTDGRHYHIDNYGDGTCSLLVTGLEASDAGCYTCRVTNKFGRIS
HSAQVTVTGTAMTSGAESEAESSSGSEVDDAFRRAARRLHRLFRTKATSDVSDEELFLSA
EEGSVELEEPSDWQTYREDDRYIYIRFETASEARQATTRFQEMFAALGILVEINILEQGP
RKVEMRIMKVAPAPAGQLAFPAAPKEHPSMLMTSDTAPVFLTELQNQEVQDGYPVSFDCV
VAGQPVPSVRWFKDGKVLEEDDHYMINEDQQGGHQLIITAVVPADMGVYRCLAENNMGVS
STKAELRVDLTSTDYDTAADATETSSYFSAQGYLSSREQEGAESTAEDGQLPQILEELQD
IQVAPGARLAKFHLKVKGYPMPRLYWFKDGQPLSPSSRILKTDKKTVHTLEIHNITKEDA
GEYSAYIRNAAGSAYSSARLLVQSPNEPEKKIDSDFHEQLVPPRFLERFTNKKVKKGSSI
TLSVKVEGQPPPTVNWLKEEANENVLWIQADTPGYKVASSNLQHSLILLDIGKQHEGSYT
CIATNGAGQSICSATLKVTDDGAAREQKKVKEALISNLLQGAGAGSAQTSETTGFNEVDQ
DKKGEPSEVHEGRGHISLADVGTEEFLQKLTSQITEMVSAKITQATLRVPGGESDDESKT
PSPSPRHGRSRPSSSVQESSSESEDGDARGEIFDIYMVTANYLPLGADPEAITLREGQYV
EVLDSAHPLKWLVRTKPTKSSPSRQGWVSPAYLDKRLKLSPEWAATEVPEFPGEPVSEDE
YKKRLNVVIQDLLSSEKDFVSALSFVQTHHLQHLESCPSVPASVSSQKPVIFRNISDIGL
FHAERFLQELQKCDTDDDVAMCFIKNEGDFEKYIQYLVGRVQAESVVVSKAVQEFYKKYS
EEKLSGADPSQPPLPPLQHYLEKPIHRIQQYQTVIKELIRNKARNGQNCALLEQAYAVVS
ALSQRAENKLHVSLMENYPGTLEALGEPIRQGHFIVWEGAPGARMAWKGHNRHVFLFRNH
LVICKPKRDSRTDTYSYVFRNMMKLSNIDVNDQVEGDDRAFEVWHEREDSVRKYLLQART
VIIKNSWVKEICGIQQRLSLPVWNPPDFEEELADCTAKLGETVKLACRVTGTPKPIVSWY
KDGKPVDVDRHHIFIEDPDGSYALILDNLMSVDSGQYMCFAASAAGNASTLGKILVLVPP
RFVNKVRNAHFVEGEDIQFTCTIEGAPYPQIRWYKDGSLLSESSKYQMFNEPRSGVLVLV
IKKACREDMGYYECELSNKLGSARSGAELSVQSTALLAQEKRGEQAITIEVTEQETKVPK
KTIIIEETITTVVKSPRGRQRTSHSKSPSRSPSRRSAAQTPRSSMLTPEPLYSSASKQQV
LRSESEAVRTTVIPELYVTEVGEHRAATSRATIVETRVGEQRPKWVEVEEIIEVKVKKSD
QRSSSPSRPEKDNSGVLTFTLPSPRPRPTEEDPNTNNSNNTLMAQDKFSSSADGLSDRSS
MVVEAEEGETTELNEDLSLPCSSEEVGNDPMEQDVIDIQGRDTKILTHNGKILTLADLED
YIPQKGETFGCKDQPSITTDDKPFEISVLQTEINEPTIGQPILLNVGRPVSPKPPPGFFS
KFKEHVPQATPRSHPASPTPIGTGASPGNPPPFPVKPAFCTKVQHSVDHSQPSFRTEVSA
QTISFGTVGETVTLHINPDSHDASQS
Download sequence
Identical sequences F6TWE8
ENSMODP00000017211 13616.ENSMODP00000017211 ENSMODP00000017211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]