SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017293 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017293
Domain Number 1 Region: 137-183,222-270
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000282
Family I set domains 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017293   Gene: ENSMODG00000013832   Transcript: ENSMODT00000017612
Sequence length 675
Comment pep:novel chromosome:BROADO5:4:383525200:383537396:1 gene:ENSMODG00000013832 transcript:ENSMODT00000017612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENLDLLFLSSREGLSRGQDGQVSQRCVRACPRVPPPSNVEQWYGPPPAPAAPSPRGFQS
PPIPSHLFPSLLPHYLGAAAPEAHQHPMAPAAPGPHGRTGAPLDPLGWNPRRRGALPLPL
LLLLLALWCSAPVGCIQVTVSNPFQVVILFQPVTLPCSYQLSGVPTLPIVVWKYKSFCRN
RITDAFSPASADSQLNAQLAAGNPGYNPYVECQDSVRTVRVVATKQGNAVTLGDFYQGRR
ITITGNADLTFDQTAWGDSGVYYCSVISAQDLQGNNEAYAELIVLGRTSGVAELLPDFQI
GPMEDWLFVVVVGLAAFLVFLLLGICWCQCCPHTCCCYVRCPCCPEKCCCPEALYAAGKA
ATSGVPSIYAPSVFAPSTYAHLSPAKAPSPPPMIPLGPVYNDFDRQSSVGGHSSQVPLLR
DTDSVRNSEVRSGYRIQANQQDDSMKVLYYMEKELANFDPSRPGLPNGRVERAMSEVTSL
HEDDWRARPHRGPALTPIQDEDLDYHSRSPGGWGRERPHDRYGERPHDPYGDWGAGRPRA
RSVDALDDLARPSSVESGRTSPSERSRSKAYAPLRSRSRDDLYSRSGDPHYEDFRSRGRA
LDDSRRDPHENHRRSRDPEYDGRFLEEVMRKKGVGERRRPYREEEEEPYYPPAPPPYTET
DSQASRERKLRKVSG
Download sequence
Identical sequences F6SDP9
ENSMODP00000017293 ENSMODP00000017293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]