SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017304 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017304
Domain Number 1 Region: 2-133
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.16e-43
Family Eukaryotic proteases 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017304   Gene: ENSMODG00000027354   Transcript: ENSMODT00000017623
Sequence length 146
Comment pep:novel chromosome:BROADO5:6:198153832:198160829:1 gene:ENSMODG00000027354 transcript:ENSMODT00000017623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGDTASEKRWPWHVSLWLETRLICGGSLIHSKWVITAAHCFRNSNATDLYSVLMGSIHL
RSKTSVRVPVKNIFKHPNFSSQYPHRNDIALVELQSAVGFSEFILPVCLPTPEFHYEEKS
SCWMTGWGALITSGEVKSINMHLLGT
Download sequence
Identical sequences F6X6N3
ENSMODP00000017304 ENSMODP00000017304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]