SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017334 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017334
Domain Number 1 Region: 238-329
Classification Level Classification E-value
Superfamily Immunoglobulin 6.81e-16
Family I set domains 0.015
Further Details:      
 
Domain Number 2 Region: 25-139
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000255
Family V set domains (antibody variable domain-like) 0.0017
Further Details:      
 
Domain Number 3 Region: 140-240
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000298
Family C1 set domains (antibody constant domain-like) 0.079
Further Details:      
 
Domain Number 4 Region: 334-416
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000731
Family I set domains 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000017334
Domain Number - Region: 384-500
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000375
Family C2 set domains 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017334   Gene: ENSMODG00000013859   Transcript: ENSMODT00000017653
Sequence length 582
Comment pep:novel chromosome:BROADO5:4:383548895:383559306:1 gene:ENSMODG00000013859 transcript:ENSMODT00000017653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRYLTALPLFWIMIAASRGGQWGAWMPSSISAFERTCVSIPCRFDFPDELRPAVVHGVWY
FNSPYPKNYPPVVFKSRTHVVHESFQGRSRLLGDLGLRNCTLQLTHLSPELGGKYYFRAD
LGGYNQYTFSEHSTLDIINTPSIVVPPEVVAGTEVEISCMVPDNCPELHPTLSWLGHDGL
GAPAVLGRMREDGGTWLQASLLHFVPTREANGHRLGCQVTFPNTTFQFEGYASLDIKYPP
LIVEMNTSVEAIEGSQVSLLCGADSNPTSLLTWMRDGAVLREAVARSLALELEDLTPEED
GIYACLAENAYGQDNRTVGLSVMYAPWKPSVNGTVVAVEGEAVSILCSTQSNPDPILTIF
KEKQILATVIYESQLLLELPAVTAEDDGEYWCVAENQYGQRASAFNISVEFAPVILLDSH
CAAVRDMVQCVCAVKSNPEPAVAFELPSRNVTVNETEREFVYSERTGLVFTSILTLRGQV
QAPPRVVCSARNLYGTKTLELPFQGANRLMWAKIGPVGAVVAFAILIAIVCYITQTRRKK
NMTESPSFASGENPPVLFSSDFRIPGVPEKSESKEVSTLGSY
Download sequence
Identical sequences F6WQ33
XP_007491890.1.35504 ENSMODP00000017334 ENSMODP00000017334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]