SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017425 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017425
Domain Number 1 Region: 1-257
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.2e-82
Family Eukaryotic proteases 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017425   Gene: ENSMODG00000013936   Transcript: ENSMODT00000017750
Sequence length 284
Comment pep:novel chromosome:BROADO5:6:197658857:197664484:1 gene:ENSMODG00000013936 transcript:ENSMODT00000017750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGHYHPFRKIIGGEIATAQRWPWQASLQVNRVHMCGGSLINKEWVITAAHCDMFVIFSLS
HRNYDYTVKLGDISYFATNLSTVVSVKDILIYPRYAELIFYRNDLALVQLASPVTYNQMI
QPVCLPNDNLNLKNGTRCWVTGWGKTSTDESKRGPSVLHEADQFIIENDLCNKLLRKHYF
FSKFIFVINKKMICAYHPEGKDACQGDSGGPLVCQFGKHTWVQVGIVSWGIGCGEEAVPG
VYTRVSGFSKWIIKSMNLRNSSILASSCLLLFSMLLPWSILIHL
Download sequence
Identical sequences F6SCM4
ENSMODP00000017427 13616.ENSMODP00000017427 ENSMODP00000017425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]