SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017466 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017466
Domain Number 1 Region: 21-109
Classification Level Classification E-value
Superfamily Immunoglobulin 7.64e-27
Family V set domains (antibody variable domain-like) 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017466   Gene: ENSMODG00000013971   Transcript: ENSMODT00000017792
Sequence length 109
Comment pep:known chromosome:BROADO5:3:527502991:527503509:-1 gene:ENSMODG00000013971 transcript:ENSMODT00000017792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALISLLLPFLTVVTGSLASYVLTQIPSMSVALGQTVTITCAGDQLDDRYAHWYQQKRSQ
TPPELVIYKDKERPEVISDRFSGSSSNKVATLTISGVQAEDESDYYCLS
Download sequence
Identical sequences F6R6Y3
ENSMODP00000017466 13616.ENSMODP00000017466 ENSMODP00000017466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]