SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017468 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017468
Domain Number 1 Region: 46-136
Classification Level Classification E-value
Superfamily Immunoglobulin 1.26e-28
Family C1 set domains (antibody constant domain-like) 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017468   Gene: ENSMODG00000013972   Transcript: ENSMODT00000017794
Sequence length 149
Comment pep:novel chromosome:BROADO5:3:527539467:527542313:1 gene:ENSMODG00000013972 transcript:ENSMODT00000017794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPDRFSDQPSPRGPKRTCRQPGFWSNSQSSWHIFGKGTKLIVLGQPKASPMVMAYGPSQD
ELRTPTATLTCLISGFYPGSLEVTWTKNGSPVSSGVLTSQPVRQTDNKYSASSYLSVNPN
QWGENNQYMCKVTHEGQVIEKELSASQCT
Download sequence
Identical sequences F6R6W5
ENSMODP00000017468 ENSMODP00000017468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]