SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017512 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017512
Domain Number 1 Region: 35-143
Classification Level Classification E-value
Superfamily Immunoglobulin 1.13e-17
Family V set domains (antibody variable domain-like) 0.006
Further Details:      
 
Domain Number 2 Region: 110-235
Classification Level Classification E-value
Superfamily Immunoglobulin 2.5e-16
Family C1 set domains (antibody constant domain-like) 0.026
Further Details:      
 
Domain Number 3 Region: 254-332
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000145
Family C1 set domains (antibody constant domain-like) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017512   Gene: ENSMODG00000014000   Transcript: ENSMODT00000017838
Sequence length 503
Comment pep:novel chromosome:BROADO5:1:450823878:450878556:-1 gene:ENSMODG00000014000 transcript:ENSMODT00000017838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPGSTLPRIINATGEDLFLLQSCLCLGAQEQELQVLQPKEPVSVAKGLTVTLNCTATSN
DLPGPVKWFKGAGPQRKEIYNFRGGSNPRIKAVVPSSNTDFSINISNITPEDTGTYYCVK
FKKGNPDTEFKSGGGTMLSVRAKPSQPLVSGPQGRINVGQVENFTCKAHGFSPKKIELKW
LKNNNDITTNLPKIFPENNSVSYNVTSTTQVKLEANDVHSKIICEVDHETLETPLQGKMN
LSSIIRVLPKVNIYRDLLPMNLANVTCEVKKFFPNIVDISWLENGTERDKIKNHNATENN
DGTYSFNASFQVNMSLVKEAKEITCVVTHDSQTSISNKTIIPLISHSGKTDETKESQQPQ
NIFIAVSIVSIVLVALLIATIYLIRAKQKKAKGSTSSTRLHEPEKNARDLSQVRTIQDSN
DINNDITYADLNLPRGKKSAPRAVESNNQTEYASIQTGPSPQREDNLTYADLDMVHLNRS
SKKATTRPEESYSEYASVQVQRK
Download sequence
Identical sequences F6R8N8
ENSMODP00000017512 13616.ENSMODP00000024406 ENSMODP00000024406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]