SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017571 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017571
Domain Number 1 Region: 13-116
Classification Level Classification E-value
Superfamily Immunoglobulin 1.41e-16
Family I set domains 0.022
Further Details:      
 
Domain Number 2 Region: 112-217
Classification Level Classification E-value
Superfamily Immunoglobulin 4.98e-16
Family I set domains 0.033
Further Details:      
 
Domain Number 3 Region: 299-368
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000319
Family I set domains 0.019
Further Details:      
 
Domain Number 4 Region: 214-299
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000822
Family I set domains 0.016
Further Details:      
 
Domain Number 5 Region: 382-496
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000074
Family C1 set domains (antibody constant domain-like) 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017571   Gene: ENSMODG00000014051   Transcript: ENSMODT00000017897
Sequence length 695
Comment pep:novel chromosome:BROADO5:4:384007861:384012027:1 gene:ENSMODG00000014051 transcript:ENSMODT00000017897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EALIGLSPLPGHAPHFLQQPEDLEVVLGEEATLPCVLGSYHGLVQWTKDGLALGGERDLP
GWSRYWISGDRTTGHHDLHIRAAELGDEASYECQATQAALRSRPARLQVLVPPEAPEVLG
APTVALVAGVPGNLTCRTRGGARPMPELLWFRDGVRLEGATYSQTLLASGILGAVESSLS
ITPSAQDDGASFICQARSPALPGGRDTKVTLSLQYPPVVTLSAEPQTVPEGGKVTFLCRA
TAHPPVIGYRWAKGGSVLPGARGPLLEVKADASFLTEPVSCEATNAVGSTNRSTALDVQF
GPLLLSAPEPVAVDVGEDASFTCTWKGNPPPRVTWARRGGSKILGSGPTLRLVAVGPGDA
GSYQCRAEPGPSGMGGGLGEATLTVHGPPVVTALHSPPADLGAPARLECLVLGSPAPDAV
VWSWGEGAMASGSRGRFRVETVPAPGAAGSGPRGLVSMLHISGTREADFTRDFNCSALNR
LGEAGARAGLTRNAPQPLVRLVAGVAAAATAFLLLLVAGGAHCCWRRARARISKRDILVQ
ITDSDGSSPRAPEEEDEGSGEERSPGTSHTKQSYLEAEEEAGPEAKDPTNGYYKVRGVSG
SQDPGAALFSSPASPVFPASPSGLYDLTPHLALFPPDLSGLYRPREGYLTTPYARAFSSY
VRSTPYGAPEPAPGAPHFSYTVLPVPGHQRLQTHV
Download sequence
Identical sequences F6U8N8
ENSMODP00000017571 ENSMODP00000017571 13616.ENSMODP00000017571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]