SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017577 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017577
Domain Number 1 Region: 88-182
Classification Level Classification E-value
Superfamily Immunoglobulin 8.49e-22
Family I set domains 0.027
Further Details:      
 
Domain Number 2 Region: 235-311
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000056
Family Fibronectin type III 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000017577
Domain Number - Region: 32-93
Classification Level Classification E-value
Superfamily L domain-like 0.0034
Family Ngr ectodomain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017577   Gene: ENSMODG00000014058   Transcript: ENSMODT00000017903
Sequence length 444
Comment pep:novel chromosome:BROADO5:4:384040555:384042812:1 gene:ENSMODG00000014058 transcript:ENSMODT00000017903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XXXXXXXXXXXXXXXXLFSRLPVLSRPRPFAPASALVLAFGGNPLHCNCELVWLRRLARE
DDLEACASPPALGGRSFWAVREDEFVCEPPVVTHRSPPVAVAEGRTASLRCRAAGDPEPR
VRWVSPRGRLLGNSSRTRAFLNGTLELLAATPGDGGVFTCIAANAAGEATASVELTVGPP
PPQLANSTSCEPRGEGEDGEGGAPLTPSSSSSSTSSSLAPLAPRAPEHDGDDGGSVQVAE
RSATAALIRWPDHGPVPGLRMYQIQYNSSADDILVYRMVPAGSRSFHLTDLVSGRTYDLC
VLAVSEDGATGLTATRAVGCARFSTEPELRPCRSPHSAAPVLGGTMIIALGGVIVASVLG
FIFLLLLRYKVHGDQPPGKPAARGGVSSVCSQTNGGAPAPGPESSASDSDPTPPTPIKGH
TLVQLDLEPSRGPRGRLAHERGGP
Download sequence
Identical sequences F6U8K8
ENSMODP00000017577 ENSMODP00000017577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]