SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017650 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017650
Domain Number 1 Region: 1177-1285
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-35
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 2 Region: 479-593
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-34
Family Spermadhesin, CUB domain 0.00078
Further Details:      
 
Domain Number 3 Region: 1700-1809
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.67e-33
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 4 Region: 1523-1642
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.93e-32
Family Spermadhesin, CUB domain 0.00065
Further Details:      
 
Domain Number 5 Region: 305-424
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-31
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 6 Region: 138-249
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-29
Family Spermadhesin, CUB domain 0.00068
Further Details:      
 
Domain Number 7 Region: 1872-1979
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.58e-29
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 
Domain Number 8 Region: 1003-1112
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-27
Family Spermadhesin, CUB domain 0.00072
Further Details:      
 
Domain Number 9 Region: 2052-2156
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.42e-27
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 10 Region: 651-772
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.8e-26
Family Spermadhesin, CUB domain 0.0024
Further Details:      
 
Domain Number 11 Region: 830-939
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.22e-25
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 12 Region: 1345-1460
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.97e-24
Family Spermadhesin, CUB domain 0.0057
Further Details:      
 
Domain Number 13 Region: 2436-2504
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.42e-19
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 14 Region: 2677-2744
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.62e-19
Family Complement control module/SCR domain 0.00074
Further Details:      
 
Domain Number 15 Region: 2853-2922
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.35e-17
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 16 Region: 2493-2560
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.61e-17
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 17 Region: 2793-2858
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.18e-16
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 18 Region: 2735-2804
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000101
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 19 Region: 2973-3041
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000104
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 20 Region: 75-147
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000189
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 21 Region: 2349-2411
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000723
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 22 Region: 2608-2670
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000103
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 23 Region: 2552-2619
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000148
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 24 Region: 1814-1882
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000202
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 25 Region: 1641-1703
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000229
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 26 Region: 1290-1357
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000836
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 27 Region: 942-1005
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000131
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 28 Region: 2158-2231
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000135
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 29 Region: 599-659
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000195
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 30 Region: 2905-2967
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000025
Family Complement control module/SCR domain 0.0007
Further Details:      
 
Domain Number 31 Region: 1117-1180
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000324
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 32 Region: 253-315
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000459
Family Complement control module/SCR domain 0.00095
Further Details:      
 
Domain Number 33 Region: 2221-2290
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000082
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 34 Region: 1467-1531
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000181
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 35 Region: 1984-2047
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000297
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 36 Region: 424-492
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000057
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 37 Region: 2293-2360
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000125
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 38 Region: 3032-3090
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000126
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 39 Region: 772-834
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000031
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 40 Region: 1-38
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000327
Family Spermadhesin, CUB domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017650   Gene: ENSMODG00000018179   Transcript: ENSMODT00000017978
Sequence length 3332
Comment pep:novel chromosome:BROADO5:4:415713937:416167720:-1 gene:ENSMODG00000018179 transcript:ENSMODT00000017978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTGASLPPPVISSKNWLRLHFTSDGNHRLKGFSAQYQVKKQIELKSRGVKLMPSKDNNQK
TSVLTQVGVSQGHNMCPDPGIPERGKRLGSDFRLGSSIQFTCNEGYDLQGSKRITCMKVS
DMFAAWSDHRPVCRARMCDAHLRGPSGIITSPNFPIQYDNNAHCVWVITAINPAKVIKLT
FEEFDLERGYDTLTVGDGGQDGDQKTVLYVLTGNTVPDLIVSTNHQMWLLFQTDSSSSSL
GFKASYEEIDQGSCGDPGVPAYGRREGSRFRHGDTLKFECQPAFELVGQKAITCQKNNQW
SAKKPGCVFSCFFNFTSPSGIVLSPNYPEEYGNHLHCVWLILAKPESRIHLAFNDIDVEP
QFDFLAIKDGATAESPVLGTFSGSQIPSSLTSSGHVARLEFQTDHSTGKRGFNITFTTFR
HNECPDPGVPVNGKRFGDSLQLGSSISFLCDEGFLGTHGSETVTCILKEGSVVWNNAVLR
CEAPCGGHLTSPSGTILSPGWPGFYKDALNCVWVIEAQPGYPIKITFDRFKTEVNYDTLE
VRDGRTYSSPLIGVYHGTQVPQFLISTSNYLYLLFSTDKSHSDIGFQIRYETVTIQSDHC
LDPGIPVNGHRHGNDFYVGALVTFSCDSGYTLSDGEPLECEPNFQWSRALPSCEALCGGF
IQGSSGTILSPGFPDFYPNNLNCTWVIETSHGKGVYFTFHTFHLESGHDYLLITENGSFT
QPLKQLTGSRLPAPISAGLYGNFTAQIRFVSDFSMSYEGFNITFSEYDLEPCEEPEVPAY
SIRKGLQFGVGDVLTFSCFPGYRLEGVARITCLGGRRRVWSSALPRCVAECGSSVTGTQG
ILLSPNFPVNYNNNHECIYSIQTQPGKGIQLKAKTFDLYEGDVLKVYDGSNNSARLLGVF
SRSDMLGVSLNSTSSSLWLDFITDSENTSKGFELQFSSFELIKCEDPGIPQFGYKVHDGG
HFAGSSVSFSCDPGYTLRGSPVLMCLTGERRAWDRPLPICIAECGGTIKGEVSGQVLSPG
YPAPYDHNLNCVWTIEADAGCTIGLHFLVFDTEEVHDVLRIWDGPVESGILLKELSGPML
PGNIHSTFSSVVLQFNTDFFTSKQGFAIQFTVSTATSCNDPGVPQNGSRSGDSREAGDSI
VFQCDPGYALQGMAQISCVKIENRFFWQPDPPTCIAPCGGDLTGPSGVILSPNYPEPYPP
GKECDWKVTVSPDYVIALVFNTFNLEPGYDFLHIYDGLDSHSPLIGSFYGSQLPERIESS
SNSLFLAFRSDASVSNLGFVIDYTENPRESCFDPGSIKNGTRSGTDLKLGSTITYYCNGG
YMIEGASTLTCVLAADGKPVWNKPRPICTAPCGGQYVGSDGVVLSPNYPQNYTRGQVCLY
FIMVPKDYVVFGQFAFFHTALNDVVEVHDGHNQHSRLLSSLSGSHTGESLPLATSNQVLI
KFSAKGQATARGFHFVYQAVPRTSATQCSSVPEPRYGRRIGSDFSVGAVVHFECNSGYSL
QGSHHIECLTVPGALAQWNVSVPICVVPCGGNLTERKGTILSPGFPEPYLNSLNCVWKIT
VPEGAGIQIQVISFVTEQNWDSLEVFDGADNTVTMLGSFSGTTVPALLNSTSNHLYLHFY
SDISVSAAGFHLEYKTVGLSSCPEPTVPSNGMKIGERYLVNDVVSFQCEPGYALQGHSHI
SCMPGTVRRWNYPPPLCIAQCGGTVEEMEGVILSPGFPGNYPSNMDCSWRITLPVGFGAH
IQFLNFSTEPNHDFIEIRNGPYETSHVIGKFSGNDLPGSLLSTSHETTVYFHSDHSQNRP
GFKLEYQAYELQECPDPEPFANGIVRGAGYNVGQSVTFECLLGYQLIGHPVLTCLHGTNR
NWDHPLPRCEVPCGGNITLYNGTVYSPGFPNPYPNSQDCTWLLTVPPGHGIHFNFSLLQT
EPDNDFITIWDGPQQTTPQLGVFTRSSAKKIIQSSSNQVLLKFHSDAAVGGIFVITFSAY
QLSKCPPPTILPNAEVITENEEFNIGDIVRYRCLPGFSLVGSEILTCKLGTHLQFEGPPP
TCEVHCPMDELLTDSTGVILSQSYPGSYPQFQTCSWVVRVEPGYNISLTVEYFLSEKQYD
EFEIFDGPSGQSPLLIALSGNYSAPLTVTSSGNNVYLRWSSDHAYNRKGFKIRYAAPYCS
VPSPPLHGSILGQPSTHPGGLIHFGCNAGYRLVGHSKAICSWHPQGYYMWNEAIPLCQAL
SCGIPKSPKNGIVFGKEYTVGTKAVYSCNEGFHLHLSPNTEATAECLETGVWSNDNIPPQ
CVAVNCPDISSISVEHGRWRLTYETQYQFNAELMLICDPGYYYTGQRVIRCQADGKWSLG
DSMPTCQIISCGDLPTPPNGHRIGTLSVYGATAIFSCNSGYTLVGSRVRECMANGLWSSS
EVRCLAFQQGLLGTFIPCGLIFLCYFLPSGDSEAGHCGTPDLIVNGQINGENYSYRGSVV
YQCNPGFRLIGMSVRICQQDHRWSGKTPFCVPITCGHPGNPANGITQGSQFNLNDMVKFI
CNEGYLAEGPSGAQCLANGQWSNALPVCRIINCTDPGHQENSIRHIQSSGPHRFSFGTTV
SYQCTHGYYLLGTHVLTCQGDGTWDRSLPQCLLVSCGHPGSPPHSQISGDTYTVGSVVRY
SCLGKRILIGNSTRMCQLDGHWSGSLPHCSAGSSVGTCGDPGIPPHGIRLGDEFVIGSLM
RFSCEPGYMLRGSSERTCHVNGSWSGTQPECEVLSCGNPGTPSNARVVFNDGLVFSSSII
YECREGYYATGLLSRHCSVNGTWTGSSPECTVINCGDPGIPANGIRLGSDFTYNKTVTYQ
CVPGHMMESDRASVLRCTKDRVWNGTKPVCKAILCKAPQPVPNGKIVGTDFMWGSSVTYA
CLEGYQLSLPAVLTCEGNGSWSGELPQCFPVFCGDPGIPPYGRRDDRGFSYRSSVSYSCP
PPLVLVGSSRRFCQSDGTWSGTQPSCIDPTLTMCTDPGVPQFGMQNNSQGYQVGSLVLFR
CQKGYLLQGSTTRTCLPNLTWSGTPPDCVPHHCKQPETPTHANVGALDLPSMGYTLIYSC
QSGFSLKGGSEHRTCKADGSWTGKPPICLAEVRPSGRPISTPREPPITKASVPGDVFAKN
SLWKGSYEYKGKRHPAILRVMGFQPATGKVNATLIDQDRVELHTSGIYKKEDFHLLLQVY
HIMSPKDISVSQFKDDNWALDGHVSSESSGGGTFVYQGFVRGQDFGHFGLQRIDLSRLET
DPESIGRHLASNSSSVAAAILVPFIGLIIAGFVLYLYKHRRRPKVPFNGYAGHENTNVRA
TFENPMYDRNLQPTDIMAPEAEFTVSTVCTAV
Download sequence
Identical sequences F6Y3Y0
ENSMODP00000017650 13616.ENSMODP00000017650 ENSMODP00000017650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]