SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017652 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017652
Domain Number 1 Region: 13-103
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000206
Family I set domains 0.018
Further Details:      
 
Domain Number 2 Region: 109-168
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000425
Family I set domains 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017652   Gene: ENSMODG00000014116   Transcript: ENSMODT00000017980
Sequence length 196
Comment pep:novel chromosome:BROADO5:1:305449484:305450442:1 gene:ENSMODG00000014116 transcript:ENSMODT00000017980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSILCAAPLSKPTIVPSNITAVETKDFSLTCQATGQIHTYQWFINGVAPAGSRIQLSPDK
RTLTLSRLTRRDNKGPYECEIRNPFYSNRSDPFTLDVAYGPDIATIDHISDQFATGINVT
LSCVADSNPPAQFTWLQNGQSVSNSASFSIITSLNHIGNYTCSATDLFTGCQKNKNTSPL
NKGEWVVLYNNFVLGS
Download sequence
Identical sequences F6Y3W6
ENSMODP00000017652 ENSMODP00000017652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]