SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017677 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017677
Domain Number 1 Region: 291-387
Classification Level Classification E-value
Superfamily Immunoglobulin 1e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 2 Region: 410-739
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.0000000000000222
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.042
Further Details:      
 
Domain Number 3 Region: 40-92
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000118
Family Ovomucoid domain III-like 0.01
Further Details:      
 
Domain Number 4 Region: 215-304
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000439
Family I set domains 0.049
Further Details:      
 
Domain Number 5 Region: 137-208
Classification Level Classification E-value
Superfamily EF-hand 0.000000000228
Family Calmodulin-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017677   Gene: ENSMODG00000014139   Transcript: ENSMODT00000018005
Sequence length 801
Comment pep:novel chromosome:BROADO5:1:304252747:305017935:1 gene:ENSMODG00000014139 transcript:ENSMODT00000018005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEFRSLEVTRRKVHFGHNGLHTSCENKHCGRGSHCIVNEETQMPECQCLEGCKPTYMPIC
GSDGKFYENHCELHRASCLQKKKIYIVHSKDCFFKGDTCTMADYNRLKHILLDLQARRHS
QNSILVPDSSSQKHFLVESLFKHLDYNSNGYLSSSELTQLMKEGSLENDFLVCSLEDLLR
FDDYNNDGSLSLQEFYTTFQVVHLSLPQEQRIIVTTVTVGLSTVLTCGIQGALRPPIIWE
RNGITLNFMDLEDINDFGEDDSLYITKVTTIHMGNYTCHAYGYEDLYQTHILQVNVPPVI
RVYPETQAQEPGVSASLKCHAEGIPTPRITWLKNGMDVGPKLSKQLSLIANGSELHINSV
RYEDTGAYTCIAKNEVGVDEDISSLFIEDSARKTLANILWREEGLSVGNVFYVFSDDGIT
IIQPTDCEIRRHIKPGEKIIASYEEICPQMEGETTQSCQWASAVNVRNRYIYVAQPVLSR
ILMIDVQTQKVQQAIGVDSLPAKLLYDKSHDQVWILSWGDMQKSQPSLQVLPEASVGESQ
PHIIRVPFEGVDDFFIPPTNLVINHIRFGFIFNKSNLTVHKIDLETMMLVKTISFHNHSC
IPHAMAYTHLGGYFFVQCKKNQTTLLTSSQVVIDSVTDTVIGPNGDIQGVPHMSPDGHFL
VSTDEESGRLQVQAITTRGEIQLMYDLQTDMHLCDLTFQPSFTESNQYYIYATSLFQTDL
LFMELSTGRVDMLKNLKEPILAQDWPWDSNTRIVKDSGLFGQYLITSAKESLFLINGQQK
TLHCEVSGMKRGNTVVWVGEV
Download sequence
Identical sequences F6XKN9
ENSMODP00000017677 ENSMODP00000017677 13616.ENSMODP00000017677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]