SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017704 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017704
Domain Number 1 Region: 287-403
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000987
Family C1 set domains (antibody constant domain-like) 0.022
Further Details:      
 
Domain Number 2 Region: 250-298
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000899
Family V set domains (antibody variable domain-like) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017704   Gene: ENSMODG00000014159   Transcript: ENSMODT00000018032
Sequence length 450
Comment pep:novel chromosome:BROADO5:2:270822672:270827346:-1 gene:ENSMODG00000014159 transcript:ENSMODT00000018032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPLCLLLALGILAVRWSDARPGPSKLECWFVEEQGGGGGMLRGVTKRPAMLLLRQGPGE
PPPRPDLDPSLYLKVYDPAGSLGDALQGSPAPSCELNHYVPSPAASDWAAGLTPEPHSPR
SLDGAWLVVSLTSPQFRLSSLLQLSQSQPVPSPVTLATVLCVSDLFGPRTSSHLNFGYSL
DWSFTIGPLNSGRALSSLGPPPFGLEWRRQHRGTGQLLLAVTPGLGSQALGSPEGAVAFA
TWDEEGVEGPWNGNGTLLLPAVQLSQEGTYLATVHLPHLQAQVALELKVQKPPKVTLSPS
PIVWAYPGQAPPELLCLISHFYPPEELNVTWEFHSSIGERSKVAGGQAWCSSYRYHPDGM
VSISAYLRPPSVKVEQHGSHYVCRVHHPSLQAKSISAQVSLEVAGVSGPSLEDGVGLFLS
AFLLLGLIKGIGWIVASLTLSMETKDKKSQ
Download sequence
Identical sequences F6X825
ENSMODP00000031464 ENSMODP00000017704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]