SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017833 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017833
Domain Number 1 Region: 15-105
Classification Level Classification E-value
Superfamily Immunoglobulin 2.11e-28
Family C1 set domains (antibody constant domain-like) 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017833   Gene: ENSMODG00000014272   Transcript: ENSMODT00000018162
Sequence length 118
Comment pep:known chromosome:BROADO5:3:527549909:527551723:1 gene:ENSMODG00000014272 transcript:ENSMODT00000018162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YVFGAGTKLTVTGQPKASPMVMAYGPSQDELITPTATLTCLISGFYPESLDVAWTKNGSP
VSSGVHTSRPVRQTDNKYSASSYLSVNPNQWRGNAVYICKVTHEGQVIQKELSASQCT
Download sequence
Identical sequences F6X1N6
ENSMODP00000017833 ENSMODP00000017833 13616.ENSMODP00000017833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]