SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017835 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017835
Domain Number 1 Region: 14-104
Classification Level Classification E-value
Superfamily Immunoglobulin 1.97e-28
Family C1 set domains (antibody constant domain-like) 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017835   Gene: ENSMODG00000014274   Transcript: ENSMODT00000018164
Sequence length 117
Comment pep:novel chromosome:BROADO5:3:527555194:527557020:1 gene:ENSMODG00000014274 transcript:ENSMODT00000018164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFGRGTRLTVTGQPKASPMVMAYGPSQDELITPTATLTCLISGFYPESLDVAWTKNGSPV
SSGVHTSRPVRQTDNKYSASSYLSVNPNQWRGNAVYICKVTHEGQVIQKELSASQCT
Download sequence
Identical sequences F6X1K3
ENSMODP00000017835 ENSMODP00000017835 13616.ENSMODP00000017835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]