SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017876 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017876
Domain Number 1 Region: 670-1249
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 1.53e-204
Family Myeloperoxidase-like 0.000000000337
Further Details:      
 
Domain Number 2 Region: 3-184
Classification Level Classification E-value
Superfamily L domain-like 1.09e-39
Family Ngr ectodomain-like 0.0015
Further Details:      
 
Domain Number 3 Region: 279-374
Classification Level Classification E-value
Superfamily Immunoglobulin 3.01e-25
Family I set domains 0.0083
Further Details:      
 
Domain Number 4 Region: 361-456
Classification Level Classification E-value
Superfamily Immunoglobulin 1.23e-24
Family I set domains 0.0066
Further Details:      
 
Domain Number 5 Region: 462-550
Classification Level Classification E-value
Superfamily Immunoglobulin 1.82e-23
Family I set domains 0.02
Further Details:      
 
Domain Number 6 Region: 180-274
Classification Level Classification E-value
Superfamily Immunoglobulin 5.31e-23
Family I set domains 0.011
Further Details:      
 
Domain Number 7 Region: 1350-1407
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000146
Family VWC domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017876   Gene: ENSMODG00000014304   Transcript: ENSMODT00000018205
Sequence length 1413
Comment pep:novel chromosome:BROADO5:1:542634730:542731533:1 gene:ENSMODG00000014304 transcript:ENSMODT00000018205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HRDLRFNRIREIQPGTFKRLKNLNTLLLNNNQIKRIPSGSFEDLENLKYLYLYKNEIQSI
DRQAFKGLASLEQLYLHFNQIETLDPESFNHLPKLERLFLHNNRIAHLVPGTFSHLNSMK
RLRLDSNALHCDCEILWLADLLKTYAESGNAQAAATCEYPRRIQGRSVATITPEELNCER
PRITSEPQDVDVTSGNTVYFTCRAEGNPKPEIIWLRNNNELSMKTDSRLNLLDDGTLMIQ
NTQETDQGIYQCMAKNVAGEVKTQEVTLRYFGSPARPSFVIQPQNTEVLVGESVTLECSA
TGHPLPRITWTKGDRTPLPTDPRVNITPSGGLYIEKVIQEDSGEYICFAANNVDSIHATA
YIIVQAVPHFTVTPQDRVVIEGQTVDFQCEAQGYPQPVIAWTKGGSQLSVDRRHLVLSSG
TLRISSVALHDQGQYECQAVNIIGSQRVAVHLTVQPRVTPVFASIPRDMTVEVGTNVQIP
CSSQGEPEPVITWNKDGVQVTESGKFHINPEGFLTINDVGPADEGRYECVARNTIGYSSV
SMVLSVNVPDVSRNGDPFVATSIVEAIATVDRAINSTRTHLFDSRPRSPNDLLALFRYPR
DPYTVEQARAGEIFERTLQLIQEHVQHGLMVDLNGTSYHYNDLVSPQYLSLIANLSGCTA
HRRVNNCSDMCFHQKYRTHDGTCNNLQHPMWGASLTAFERLLKSVYENGFNLPRGINPNR
LYNGFPLPMPRLVSTTLIGTESITPDEQFTHMTMQWGQFLDHDLDSTVVALSQARFSDGQ
HCSSVCTNDPPCFSVMIPPNDPRVRNGARCMFFVRSSPVCGSGMTSLLMNSVYPREQINQ
LTSYIDASNVYGSSDHEAREIRDLASHRGLLRQGIVQRSGKPLLPFATGPPTECMRDENE
SPIPCFLAGDHRANEQLGLTSMHTLWFREHNRIATELLKLNPHWDGDTIYYETRKIVGAE
IQHITYNHWLPKIFGEVGMKMLGEYKGYDPSVNSGIFNAFATAAFRFGHTLINPILYRLD
ENFEPIPQGHIPLHKAFFSPFRIVNEGGIDPLLRGLFGVAGKMRVPTQLLNTELTERLFS
MAHTVALDLAAINIQRGRDHGIPPYHDFRVYCNLSSASTFEDLRNEIKNPHIREKLQGLY
GSPLNIDLFPALMVEDLVPGSRLGPTLMCLLSTQFKRLRDGDRLWYENPGVFSPAQLTQI
KQTSLARILCDNSDNITHVQRDVFRVAEFPHGYSSCDEIPKVDLRMWQDCCEDCRTRGQF
NVFSYHFRGRRSLEFSYQEDKPAKRTKARKILSTVKQSQPFNNFTSSSDEHMNVPATNDF
KEFVLEMQKTITGLRKQIKKLESRLSKTECTDEKGKSYSSNEKWKRDSCTVCECKDGQIT
CFVESCQPADCPAPVKIKGECCPVCLKNTVSKP
Download sequence
Identical sequences F6W4P8
ENSMODP00000017876 ENSMODP00000017876 13616.ENSMODP00000017876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]